KEGG   Mycobacterium abscessus ATCC 19977: MAB_0623Help
Entry
MAB_0623          CDS       T00657                                 

Definition
Probable dehydrogenase
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MAB_0623
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     MAB_0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
622050..623651
Genome map
AA seq 533 aa AA seqDB search
MPGRSDMPSADVIIVGYGVAGASAALAALERGASVIILERFDGGGASAISGGIYYAGGGT
NIQRDAGVEDTPELMLEYLRLEVGDAVKPETLQKFVDGSVDTLNWLQGYGVPFEGSLAPF
KTSYPTDDYYLYFSGSESSGMARAATPPRQRGHRAFGRGVSGKALFAPLADSAERLGADV
WRQTRVTGLVVEEGRVVGVRGMTLKDAPAWARRLYSRLTHYATKPGIYYPPMRKTLEGPA
YALERRFAKPFEIRADDGVILSSGGFIANRELVRRHAPAYLDGLELGTAGDDGTALKLAE
PLGAATGHLDEISAWRFIVPPAAFLGSLLVDTKGQRMIDESRYGAALGKEIVRTAGGVGY
LVADQPLVKRARQQLGSQTLWFQRIQAEAFLNVGRKKAGSIEELAAKAGIDPEGLARTVS
EHNRAIAGGTPDPLGKPDDIRVPIERAPFYLFNVSIKTNMLNPCPMLTLGGLVVDEETGA
VQTTSGAAIPGLYAAGRAAVGICSNSYVSGLSLADCVFSGRRAGTETGRRIDA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
gtgccgggtcgttcggacatgccgtcggccgatgtcatcatcgtcgggtatggggtggcg
ggtgcgtccgccgcactggcggccctggagcgcggggcgtccgtgatcatccttgagcga
ttcgatggtggcggagcttcggccatctcaggaggcatttattacgccggcggcggcact
aatattcagcgtgacgccggggtcgaggacactccggagctgatgctggagtacctgcgg
cttgaggtcggcgatgccgtcaaacccgagacgcttcagaaattcgtcgacggcagcgtg
gacactctgaattggctgcaaggttacggagttccgttcgaaggttcgctggcacctttc
aagacttcgtacccgactgacgactactacctctacttttccggcagtgaatcctccggc
atggcgcgtgccgccaccccgccccgccagcgcgggcaccgtgcctttggccggggggtg
tccggtaaggcgttgtttgcgcccttggcggattctgcggagcgtttgggggccgacgtg
tggcggcagaccagggtcaccgggctggtcgtcgaggaggggcgcgttgtcggggtgcgc
gggatgacgctgaaggacgcgccggcctgggcccgccggttgtactcgcgtcttacgcac
tacgcgaccaagccgggcatctactacccgccgatgcgaaagacgctcgaaggccccgca
tatgcgttggagcgccggttcgccaagccatttgagatccgtgccgacgacggagtgatc
ctgtcgtccggtggttttatcgccaatcgtgagctcgtacggcggcatgctccggcctat
ctggacgggctcgagctcggcaccgccggcgacgacggaaccgcactgaagctggccgag
ccgttgggcgcggcaacggggcatctcgatgagatctcggcctggcggtttattgtgccg
cctgccgctttcctgggttccttgctggtagataccaaggggcagaggatgattgacgag
tctcgctatggagcggccttgggcaaggagattgtgcgtacggccggcggagtgggatat
ctggttgccgaccagccgttggtgaagcgggcccgccaacagttgggatcgcagacgctg
tggtttcagcggattcaggccgaggcgttcctcaacgtggggcgcaagaaggccgggtcc
atcgaggagctggcagccaaggctggtatcgacccggaaggattggcgcgcaccgtatcc
gaacacaaccgggccattgccggtggcacccccgatccgctggggaagcccgatgacatc
agggtgcccattgagcgggcgccgttctatctgttcaacgtgtccatcaagaccaacatg
ctcaatccgtgtccgatgctgactcttggcggtctggtcgtggacgaggagactggtgcc
gtgcagaccacgtcgggcgcggcgatcccggggctctatgccgccgggcgtgcggcggtc
ggtatctgctcaaattcgtatgtgagcggattgtccctggccgactgcgtcttctccgga
cgccgggccgggaccgagactggaaggcgtatagatgcttag

DBGET integrated database retrieval system