KEGG   Mycobacterium abscessus ATCC 19977: MAB_0625Help
Entry
MAB_0625          CDS       T00657                                 

Definition
Probable acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MAB_0625
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAB_0625
   00650 Butanoate metabolism
    MAB_0625
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MAB_0625
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAB_0625
   00622 Xylene degradation
    MAB_0625
   00621 Dioxin degradation
    MAB_0625
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MAB_0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
624440..625348
Genome map
AA seq 302 aa AA seqDB search
MASKASVAIVGSGNISTDLLYKLQRSEWLEPRWMIGIDPESEGLKRARGFGLETSHEGVD
WLLGQDEKPDLVFEATSAYVHKAAAPRYEEAGIRAIDLTPAAVGPAVVPPANLRAHLDAP
NVNMITCGGQATIPIVYAVSRVVEVPYAEIVASVASVSAGPGTRANIDEFTKTTSKGVEV
IGGAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRAAIAASIHDVVSQVQQYVPGYRLL
NEPQFDEPSVVNGGNHVVTTFVEVEGAGDFLPPYAGNLDIMTAAATKVGEEIAKELLSAK
VS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtcaaaggcatctgtagcgatcgtcggttcgggaaacatcagcaccgacctgctg
tacaaattgcagcgttccgagtggctggagccgcggtggatgatcggcatcgaccccgag
tccgaaggtctcaagcgtgcccgcggtttcggtctggaaacctcgcacgagggtgtggac
tggttgcttgggcaggacgagaagccggatctggtcttcgaggcaacgtccgcctacgtg
cacaaggccgccgcgccacgctatgaggaagcgggcatccgggccatcgatctgactccc
gcggcggtgggaccagccgttgtgccgcccgcgaatctgcgcgcccaccttgatgctccg
aacgtcaacatgatcacctgtggtggccaggcgacgattccgatcgtgtacgcggtgtcg
cgcgttgtcgaggtgccttacgccgagatcgtcgcctcggtcgcctcggtgtccgcagga
cccggaacgcgcgccaacatcgacgagttcaccaagaccacgtccaagggggtggaggtg
atcggaggcgccaagcgcggaaaggcgatcatcatcctgaaccccgcggatccgccgatg
atcatgcgcgacacaattttctgcgcaattcctgaggacgcggaccgtgcggcgattgcc
gcgtcgattcacgatgtggtgagccaggttcagcagtacgtgcccggataccggctgctc
aatgagccgcagttcgatgagccgtcggtggtcaacggcggcaaccatgtcgtcactacc
ttcgtcgaggttgagggcgccggtgacttcttgccgccgtatgccggaaacctggacatc
atgaccgcggccgcgaccaaggtcggcgaggaaatcgccaaagaacttctatctgcaaag
gtttcgtga

DBGET integrated database retrieval system