KEGG   Mycobacterium abscessus ATCC 19977: MAB_0690Help
Entry
MAB_0690          CDS       T00657                                 

Definition
Probable protease II PrtB
Orthology
K01354  
oligopeptidase B [EC:3.4.21.83]
Organism
mab  Mycobacterium abscessus ATCC 19977
Brite
Enzymes [BR:mab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.83  oligopeptidase B
     MAB_0690
Peptidases [BR:mab01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   MAB_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
692207..694342
Genome map
AA seq 711 aa AA seqDB search
MSGPVRPPVANRIDTLREYHGDTFVDPYEWMREKETPEVIAYLEAENAYVDDQLGHLAEL
RTTIFGEIKSRTKETDLSIPTRMGQWWYYARSFEGKQYGVHCRCPIGDPNDWTPPALDHD
VPGEQILLDGNVEAAGHDFFSLGAATVSPDGNTLAYSVDVVGHEMYTLRFKNLRTGEMYP
DEIADIGAGATWAMDSRTLYYPVIDEAFRPYAIRRYTLGGGAEPVEVFSEPDERFWIGVG
RTRSDRFVAISVHSSVTSEILIGDAEDPAATFSPVWLRRNGIEYTVDHIVVGGEDRLLIL
HNDGAVNFALAEMPVAAVVDGPADPSAARTLIAHRDDVRLDGVEAFAQRFVIGYRREALP
RIQVWPVTADGYGSPQEVEFDSELMLSGLGDNPEWDSPLLRVGCASFITPTRVYDLDVHT
GERTLLKEQPVLGGYRREDYVERREWALAVDGTRVPLSVVHRRGITSPSPTVLYGYGAYE
MCEDPQFSIGRLSLLDRGVVFVIAHVRGGGEMGRLWYEDGKMLHKKHSFSDFVSAARHLV
DSGVALPNRLVAWGGSAGGLLVGAAVNLAPELFAGVLAQVPFVDPVTTICDPSLPLTVTE
WDEWGNPLENKDVYDYIKSYSPYENIRAADYPSILAMTSLHDSRVLYVEPAKWVAELRHT
TTGERPILLKTEMTAGHGGISGRYERWKESAFQLAWLLDILGAQGETPNAR
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggccggtacgcccgcccgtcgcgaaccgtatcgacactctccgcgagtatcac
ggggacaccttcgtcgatccgtatgaatggatgcgtgaaaaggagacccccgaggtcatc
gcgtatttagaggcggaaaacgcctatgtcgatgaccagcttggccatctggcggagctg
cgcaccaccatcttcggtgagatcaagtcgcgcaccaaggagaccgacctttcgatcccg
acccggatggggcagtggtggtactacgcccgcagcttcgagggaaagcagtacggagtt
cattgtcgttgtccgataggggatccgaacgactggacaccgccggccctggatcacgac
gttcctggtgagcagatcctgctcgacggtaacgtggaggcggcaggacacgacttcttc
tcgctcggtgccgccaccgtcagtccggacgggaacacactggcctattcggtcgacgtc
gtcggccatgagatgtacacgctgcggttcaagaacctgcgcaccggcgagatgtatccg
gacgagatcgccgatatcggcgccggtgcaacctgggcgatggacagccgcacgctctac
tatcccgtgatcgatgaggccttccggccctacgccattcgccggtacacattgggtggc
ggcgcggaacccgtcgaggtgttctccgaaccggacgagcgattctggatcggggtgggc
cgcacccgcagtgatcgctttgtcgccattagtgtgcattcgtcggtgacatcggagatc
ctgatcggggacgccgaggatcccgcggcgaccttttcgccagtctggttgcgccgcaac
ggtatcgaatacaccgtcgatcacatcgtggtcggcggtgaggacaggctgctgattctg
cacaatgacggcgccgtgaatttcgcgctcgcggaaatgccggtcgccgcggtggtggac
ggaccggccgacccgtcggcggcacgcaccctgatcgcccaccgcgatgatgtgcggctg
gacggggtcgaggcattcgcacagcggttcgtgatcgggtaccggcgagaagcattgccg
cgcattcaggtctggcccgtcacggccgacggatacggttcaccgcaggaggtcgagttc
gactccgagctcatgctctcgggattgggtgacaacccggagtgggattcgccgctgctg
cgggtgggttgcgcatcgttcatcacccccacccgtgtctacgacctcgatgtgcacacc
ggggagcgcacgctgctcaaggagcagcccgtgctcggtggctatcgccgcgaggattat
gtggagcggcgggaatgggcgctcgccgtagatggcacccgggtgccactctcagtggtc
caccgcagaggtatcacgtcaccgtccccgaccgtgctgtacgggtacggcgcatacgag
atgtgtgaggacccccagttcagcatcggccggctctcgttgttggatcggggagtggtg
ttcgtcatcgctcacgtgcgcggtggtggtgagatgggccgcctctggtacgaggacggc
aagatgctgcacaagaagcacagcttttccgatttcgtatcggcagcaaggcatctcgtt
gactcaggggtcgcgctgcccaatcggctggtcgcctggggcggcagcgcgggcgggctg
ttggtgggtgccgcggtaaacctggcacccgagctgttcgccggtgtgctggcgcaggtg
cccttcgtcgaccccgtcaccaccatttgcgatccctcgctaccgctcaccgtcaccgag
tgggatgagtggggaaatcccctggaaaacaaggatgtttacgactacatcaagtcgtac
tcgccctacgagaacatccgcgccgccgactatccgagcattctcgcgatgacatcgctg
catgactcgcgggtgctgtacgtcgaacccgccaaatgggtggccgaactgcgccacacc
accaccggtgagcgacccatcctgttgaagaccgagatgacggcggggcacggcgggata
agcggccgctatgaacgctggaaggaaagcgctttccagctcgcctggctactggatatc
cttggagcgcagggggagacgccgaatgcccgatga

DBGET integrated database retrieval system