KEGG   Mycobacterium abscessus ATCC 19977: MAB_0693Help
Entry
MAB_0693          CDS       T00657                                 

Definition
Probable glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MAB_0693
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MAB_0693
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MAB_0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
696619..697107
Genome map
AA seq 162 aa AA seqDB search
MTDLASIPLTALDGSALSLADFGDNAVLVVNVASKCGLTPQYAALEKLASDYADRGLTVL
GVPCNQFMGQEPGTAEEIREFCSSTYGVSFPLLEKADVNGDNRHPLYAELIKTADAEGTA
GDVQWNFEKFLIARDGSVVNRFRPTTVPDAPEVIAAIEKELG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcgcgtccatcccgttgaccgccctggacggctcggcgctgtcacttgcc
gatttcggcgataacgccgtcctggtggtcaacgtcgcgtccaagtgcggtctcaccccg
cagtacgcggctctggagaagctggcctccgactacgccgaccgtggtctgaccgtgctc
ggagttccctgtaaccaattcatggggcaggaaccgggcacggcggaggaaattcgggag
ttctgctcgtccacctatggggtgagtttcccgctgctggagaaggccgatgtgaacggt
gacaatcggcatccgctgtacgcggagctcatcaagaccgccgatgcggagggtaccgcg
ggtgatgtgcagtggaacttcgagaaattcttgatcgcgcgggatggttcggtggtcaat
agattccggccgacaacagtgccggacgcgcccgaggtgatcgcggccatcgagaaggag
ctgggctag

DBGET integrated database retrieval system