KEGG   Mycobacterium abscessus ATCC 19977: MAB_0822Help
Entry
MAB_0822          CDS       T00657                                 

Definition
Probable acyl-CoA dehydrogenase
Orthology
K00252  
glutaryl-CoA dehydrogenase [EC:1.3.8.6]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Fatty acid degradation
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    MAB_0822
  Amino acid metabolism
   00310 Lysine degradation
    MAB_0822
   00380 Tryptophan metabolism
    MAB_0822
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.6  glutaryl-CoA dehydrogenase (ETF)
     MAB_0822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
816945..818138
Genome map
AA seq 397 aa AA seqDB search
MSTAVTPSPEMCSTPLELFDTDRRLDQDERDIAATVRKFVDTKLRPNIAEWFESATLPRD
LARQFGELGVLGMHLDGYGCAGTNAVSYGLACLELEAGDSGLRSFVSVQGSLSMYSIHRY
GSEEQKQEWLPQLASGHAIGCFGLTEPDFGSNPGGMRTRARRDGKDWILDGTKMWITNGN
LADVATVWAQTDDGVRGFVVPTATKGFAANVIHKKLSLRASVTSELVLDGVRLPDSAELP
GARGLSAPLSCLNEARFGIVFGALGAARDSLQAALDYTRTREVFGRPLSSYQLSQEKLAN
MTVQLGMGMLLALHLGRIKDSVGLRPEQVSLGKLNNVREALNIARECRTLLGASGITLEY
SPLRHANNLESVLTYEGTSEMHLLSIGRALTGQAAFR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgcagtaaccccgtcgccggagatgtgctcgaccccgctggagctgttcgac
acagatcgccggctggaccaggacgagcgcgacatcgcggccacggtgcgtaagttcgtc
gataccaagctgcgtccgaacatcgcggaatggtttgagtccgcgacacttcccagagat
ctggcacgccagttcggtgaactgggtgtgctcggtatgcacctcgacggctacgggtgt
gcgggcaccaacgccgtgagctacgggttggcttgccttgaattggaggcaggcgatagc
ggtctgcgcagcttcgtgtcggtgcagggttctctgtccatgtattcgatccaccggtac
ggctcggaagagcagaagcaggaatggttgccgcagttggcatctggtcatgccattggc
tgcttcggtcttaccgagccggacttcggatccaaccccggggggatgcgaacccgcgca
cgccgcgacggcaaggactggatactcgacggcacgaagatgtggatcaccaacggcaat
cttgccgatgtcgccacagtctgggcgcagaccgacgacggtgtgcgtggtttcgtcgtg
ccgacggccaccaagggattcgccgccaatgtgattcacaagaagctatccctgcgggca
tcggtgacctcggagcttgtgctcgacggtgtgcggctgccggattcggcggaactgccc
ggcgcccgggggctttcggctccgctgtcctgtctcaacgaagcacgtttcggcatcgtc
ttcggcgcgctgggcgccgcgcgcgacagcctgcaagcggcgcttgactatacgcgtact
cgcgaggtgttcgggcgtccgttgtcgagctatcagctcagccaggagaagctcgccaac
atgacggttcagctgggcatgggcatgctgttggcgctgcatctgggccgcatcaaggac
tctgtcgggttacggccggagcaggtcagcctgggcaagctgaacaacgtgcgtgaggca
ctcaacatcgcccgtgaatgccgaaccctattaggtgcaagcggtatcacccttgaatac
tcgcccctgcgccatgccaacaatcttgaatcggtgctcacctatgagggcacgtccgag
atgcatctgctttcgatcgggcgagcgctgaccggccaggcagccttccgctga

DBGET integrated database retrieval system