KEGG   Mycobacterium abscessus ATCC 19977: MAB_0822Help
Entry
MAB_0822          CDS       T00657                                 

Definition
(RefSeq) Probable acyl-CoA dehydrogenase
  KO
K00252  glutaryl-CoA dehydrogenase [EC:1.3.8.6]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
mab00071  Fatty acid degradation
mab00310  Lysine degradation
mab00362  Benzoate degradation
mab00380  Tryptophan metabolism
mab01100  Metabolic pathways
mab01120  Microbial metabolism in diverse environments
mab01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    MAB_0822
  Amino acid metabolism
   00310 Lysine degradation
    MAB_0822
   00380 Tryptophan metabolism
    MAB_0822
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAB_0822
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.6  glutaryl-CoA dehydrogenase (ETF)
     MAB_0822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 5963354
NCBI-ProteinID: YP_001701570
UniProt: A0A0U1BZI5
Position
816945..818138
Genome map
AA seq 397 aa AA seqDB search
MSTAVTPSPEMCSTPLELFDTDRRLDQDERDIAATVRKFVDTKLRPNIAEWFESATLPRD
LARQFGELGVLGMHLDGYGCAGTNAVSYGLACLELEAGDSGLRSFVSVQGSLSMYSIHRY
GSEEQKQEWLPQLASGHAIGCFGLTEPDFGSNPGGMRTRARRDGKDWILDGTKMWITNGN
LADVATVWAQTDDGVRGFVVPTATKGFAANVIHKKLSLRASVTSELVLDGVRLPDSAELP
GARGLSAPLSCLNEARFGIVFGALGAARDSLQAALDYTRTREVFGRPLSSYQLSQEKLAN
MTVQLGMGMLLALHLGRIKDSVGLRPEQVSLGKLNNVREALNIARECRTLLGASGITLEY
SPLRHANNLESVLTYEGTSEMHLLSIGRALTGQAAFR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgcagtaaccccgtcgccggagatgtgctcgaccccgctggagctgttcgac
acagatcgccggctggaccaggacgagcgcgacatcgcggccacggtgcgtaagttcgtc
gataccaagctgcgtccgaacatcgcggaatggtttgagtccgcgacacttcccagagat
ctggcacgccagttcggtgaactgggtgtgctcggtatgcacctcgacggctacgggtgt
gcgggcaccaacgccgtgagctacgggttggcttgccttgaattggaggcaggcgatagc
ggtctgcgcagcttcgtgtcggtgcagggttctctgtccatgtattcgatccaccggtac
ggctcggaagagcagaagcaggaatggttgccgcagttggcatctggtcatgccattggc
tgcttcggtcttaccgagccggacttcggatccaaccccggggggatgcgaacccgcgca
cgccgcgacggcaaggactggatactcgacggcacgaagatgtggatcaccaacggcaat
cttgccgatgtcgccacagtctgggcgcagaccgacgacggtgtgcgtggtttcgtcgtg
ccgacggccaccaagggattcgccgccaatgtgattcacaagaagctatccctgcgggca
tcggtgacctcggagcttgtgctcgacggtgtgcggctgccggattcggcggaactgccc
ggcgcccgggggctttcggctccgctgtcctgtctcaacgaagcacgtttcggcatcgtc
ttcggcgcgctgggcgccgcgcgcgacagcctgcaagcggcgcttgactatacgcgtact
cgcgaggtgttcgggcgtccgttgtcgagctatcagctcagccaggagaagctcgccaac
atgacggttcagctgggcatgggcatgctgttggcgctgcatctgggccgcatcaaggac
tctgtcgggttacggccggagcaggtcagcctgggcaagctgaacaacgtgcgtgaggca
ctcaacatcgcccgtgaatgccgaaccctattaggtgcaagcggtatcacccttgaatac
tcgcccctgcgccatgccaacaatcttgaatcggtgctcacctatgagggcacgtccgag
atgcatctgctttcgatcgggcgagcgctgaccggccaggcagccttccgctga

DBGET integrated database retrieval system