KEGG   Mycobacterium abscessus ATCC 19977: MAB_0822Help
Entry
MAB_0822          CDS       T00657                                 

Definition
Probable acyl-CoA dehydrogenase
Orthology
K00252  
glutaryl-CoA dehydrogenase [EC:1.3.8.6]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Fatty acid degradation
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:mab00071]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mab00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mab00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
816945..818138
Genome map
AA seq 397 aa AA seqDB search
MSTAVTPSPEMCSTPLELFDTDRRLDQDERDIAATVRKFVDTKLRPNIAEWFESATLPRD
LARQFGELGVLGMHLDGYGCAGTNAVSYGLACLELEAGDSGLRSFVSVQGSLSMYSIHRY
GSEEQKQEWLPQLASGHAIGCFGLTEPDFGSNPGGMRTRARRDGKDWILDGTKMWITNGN
LADVATVWAQTDDGVRGFVVPTATKGFAANVIHKKLSLRASVTSELVLDGVRLPDSAELP
GARGLSAPLSCLNEARFGIVFGALGAARDSLQAALDYTRTREVFGRPLSSYQLSQEKLAN
MTVQLGMGMLLALHLGRIKDSVGLRPEQVSLGKLNNVREALNIARECRTLLGASGITLEY
SPLRHANNLESVLTYEGTSEMHLLSIGRALTGQAAFR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgcagtaaccccgtcgccggagatgtgctcgaccccgctggagctgttcgac
acagatcgccggctggaccaggacgagcgcgacatcgcggccacggtgcgtaagttcgtc
gataccaagctgcgtccgaacatcgcggaatggtttgagtccgcgacacttcccagagat
ctggcacgccagttcggtgaactgggtgtgctcggtatgcacctcgacggctacgggtgt
gcgggcaccaacgccgtgagctacgggttggcttgccttgaattggaggcaggcgatagc
ggtctgcgcagcttcgtgtcggtgcagggttctctgtccatgtattcgatccaccggtac
ggctcggaagagcagaagcaggaatggttgccgcagttggcatctggtcatgccattggc
tgcttcggtcttaccgagccggacttcggatccaaccccggggggatgcgaacccgcgca
cgccgcgacggcaaggactggatactcgacggcacgaagatgtggatcaccaacggcaat
cttgccgatgtcgccacagtctgggcgcagaccgacgacggtgtgcgtggtttcgtcgtg
ccgacggccaccaagggattcgccgccaatgtgattcacaagaagctatccctgcgggca
tcggtgacctcggagcttgtgctcgacggtgtgcggctgccggattcggcggaactgccc
ggcgcccgggggctttcggctccgctgtcctgtctcaacgaagcacgtttcggcatcgtc
ttcggcgcgctgggcgccgcgcgcgacagcctgcaagcggcgcttgactatacgcgtact
cgcgaggtgttcgggcgtccgttgtcgagctatcagctcagccaggagaagctcgccaac
atgacggttcagctgggcatgggcatgctgttggcgctgcatctgggccgcatcaaggac
tctgtcgggttacggccggagcaggtcagcctgggcaagctgaacaacgtgcgtgaggca
ctcaacatcgcccgtgaatgccgaaccctattaggtgcaagcggtatcacccttgaatac
tcgcccctgcgccatgccaacaatcttgaatcggtgctcacctatgagggcacgtccgag
atgcatctgctttcgatcgggcgagcgctgaccggccaggcagccttccgctga

DBGET integrated database retrieval system