KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0851Help
Entry
MAB_0851          CDS       T00657                                 

Definition
(RefSeq) Probable fatty oxidation protein FadB
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00071  Fatty acid degradation
mab00280  Valine, leucine and isoleucine degradation
mab00281  Geraniol degradation
mab00310  Lysine degradation
mab00362  Benzoate degradation
mab00380  Tryptophan metabolism
mab00410  beta-Alanine metabolism
mab00640  Propanoate metabolism
mab00650  Butanoate metabolism
mab00903  Limonene and pinene degradation
mab00930  Caprolactam degradation
mab01040  Biosynthesis of unsaturated fatty acids
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01120  Microbial metabolism in diverse environments
mab01130  Biosynthesis of antibiotics
mab01200  Carbon metabolism
mab01212  Fatty acid metabolism
Module
mab_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MAB_0851
   00650 Butanoate metabolism
    MAB_0851
  Lipid metabolism
   00071 Fatty acid degradation
    MAB_0851
   01040 Biosynthesis of unsaturated fatty acids
    MAB_0851
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAB_0851
   00310 Lysine degradation
    MAB_0851
   00380 Tryptophan metabolism
    MAB_0851
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAB_0851
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAB_0851
   00281 Geraniol degradation
    MAB_0851
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAB_0851
   00930 Caprolactam degradation
    MAB_0851
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MAB_0851
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MAB_0851
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MAB_0851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored UDPG_MGDP_dh_N Peptidase_S49 NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 5963383
NCBI-ProteinID: YP_001701599
UniProt: A0A2C9YCW2
Position
845430..847589
Genome map
AA seq 719 aa AA seqDB search
MSANTIQWEKDADGIVTLTLDDPNGSANVMNDDYKQSMAAAVKRLVEEKDSITGVVITSA
KKTFFAGGDLTKIIQIQPENAQEAFNEVEEIKADLRTLETFGRPVVAAINGAALGGGLEI
ALATHHRIAADVKGSQIGLPEVSLGLLPGGGGVTRVTRMLGIQNGFVTVLAQGTRFNPTK
AKEVGLIDELVGSVDELIPAAKAWIKANPEAVQRWDVKGYKIPGGTPATPALAAILPSFP
SNLKKQLKGAPMPAPRAILAAAVEGAQVDFDTASRIESRYFTSLATGQVAKNMTQAFFFD
LQHINGGGSRPDGIAKQDIKKIGVLGAGMMGAGIAYVSAKAGYDVVLKDVSLEAAQKGKG
YSEKLEEKALSRGKTTQEKSSELLARIHPTADPADLAGVDFVIEAVFENTELKHKVFQEI
EDIVEPNALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIRGEKTSDEAL
ARVFDYVLAIKKTPIVVNDSRGFFTSRVIGTFVNEAVAMLAEGIEPATIEQAGSQAGYPA
PPLQLSDELNLTLMQKIRKETAEAAKAEGKELPDDPAGRVIDTLVEAGRPGRLGGAGFYD
YVDGKRTELWPGLRETFKTRNGADPANPPLQDLIERMLFAEAIETQKCFDEGVLTSTADA
NIGSIFGIGFPAWTGGVHQYILGYDGPAGKGKAGFVARAKELAAKYGDRFNPPASLLDA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaaacaccattcagtgggagaaggacgccgacggcatcgtcaccctcaccctg
gacgaccccaacggctcggccaacgtgatgaacgacgactacaagcagtcgatggccgcg
gccgtcaagcgccttgtggaagagaaggattcgatcaccggcgtggtgatcaccagcgcc
aagaagaccttcttcgccggtggtgacctgaccaagatcatccagatccagccggagaac
gcccaggaggccttcaacgaggtcgaggagatcaaggccgacctgcgtacgctggagacc
ttcggccgccccgtggtggcggccatcaacggcgccgccctcggcggtggcctggagatc
gcgctggcgacccatcaccggatcgcggccgacgtcaagggatctcagatcggtctgccc
gaggtatcgctgggcctgctgcccggtggcggcggcgtcacccgggttacccgcatgctc
ggtatccagaacggcttcgtgaccgtgctggcgcagggcacccgcttcaacccgaccaag
gccaaggaagtcggcttgatcgatgagttggtcggctccgtcgacgagctgatcccggcc
gccaaggcgtggatcaaggccaacccggaggccgtgcagcgctgggatgtcaagggctac
aagatccccggcggcaccccagcaactcccgccctggccgcgattttgccgtcgttcccg
tcgaacctgaagaagcagctcaagggtgcgccgatgcccgccccgcgggccatcctggcc
gccgcggtcgagggtgcgcaggtggacttcgacacggccagccgcatcgagagccgttac
ttcaccagcctggccaccggccaggtcgccaagaacatgacgcaggcgttcttcttcgac
ctgcagcacatcaacggcggtggctcacgtccggacggcatcgccaagcaagacatcaag
aagatcggtgtgctgggcgcgggcatgatgggcgccggtatcgcctacgtctcggccaag
gccggttacgacgtcgtgctcaaggatgtttcgctggaggcggctcagaagggcaagggt
tactccgaaaagcttgaagagaaggctctttcgcggggcaagaccacccaggaaaagtcc
agcgaactcctcgcaagaattcacccgactgccgaccctgccgacctggccggtgtcgac
ttcgtgatcgaggccgttttcgagaacaccgagctcaagcacaaggtgttccaggagatc
gaagacatcgtcgagcccaacgcgctccttggctccaacacctccaccctgcccatcacg
gggctggccacgggtgtgaagcgtcaggaggacttcatcggtatccacttcttctcgccc
gtggacaagatgccgctggtggagatcatccgcggtgagaagacctcggacgaggcgctg
gcccgggtgttcgactacgtgctggccatcaagaagaccccgatcgtcgtcaatgacagc
cgtggcttcttcaccagccgcgtcatcggcaccttcgtcaacgaggccgtcgccatgctg
gccgagggcatcgagcccgcgaccatcgagcaggccggcagccaggccggatacccggcc
ccgccgctgcagctctccgacgagctgaacctgacgctcatgcagaagatccgcaaggag
acggcggaggctgccaaggccgagggcaaggaattgccggatgacccggccggtcgtgtc
atcgacaccctggttgaggcgggccgccccggccgcctcgggggcgccggtttctacgac
tacgtggacggcaagcgcacagagctgtggcccggcctgcgggagacgttcaagacccgc
aatggcgccgaccccgccaacccgccgctgcaggacctcatcgagcgcatgttgttcgcc
gaggccatcgagacgcagaagtgcttcgacgagggtgtgctgacgtcgaccgccgatgcc
aacatcggttcgatcttcggcatcggcttcccggcctggaccggtggtgtgcaccagtac
atcctcgggtacgacggtcccgccggaaagggcaaggctggtttcgtcgcccgcgcaaag
gaattggccgccaagtacggtgaccgattcaacccgcctgcttcgctcctggacgcatag

DBGET integrated database retrieval system