KEGG   Mycobacterium abscessus ATCC 19977: MAB_0983cHelp
Entry
MAB_0983c         CDS       T00657                                 

Definition
Probable alcohol dehydrogenase, zinc-containing
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MAB_0983c
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAB_0983c
  Lipid metabolism
   00071 Fatty acid degradation
    MAB_0983c
  Amino acid metabolism
   00350 Tyrosine metabolism
    MAB_0983c
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MAB_0983c
   00626 Naphthalene degradation
    MAB_0983c
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MAB_0983c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(990267..991376)
Genome map
AA seq 369 aa AA seqDB search
MRIRSAVLHAAPIERPYRDTHPLKVIELELDPPGPGEVLVRIEAAGLCHSDLSVVDGNRI
RPVPMALGHEAAGVIAAVGPGVRDVSPGDHVVLVYVPSCGACRYCSSGRPALCPDAAAAN
GRGDLIRGGTRLHDLDGTEVRHHLGVSGFADHAVVDRNSVVVIDENVPLDTAALFGCAML
TGFGAVTHTASVRPGDSVAVLGLGGVGLAVVMSAAAAGAGEVLAIDPVPAKRELALELGA
TSACAPDEAPGGHDWVFEVVGSAAVLEQAYALTGRGGGTVSVGLPHPDARISLPALNIVA
EGRSILGSYMGSAQPQQDIPAMLALWRAGRLPVEKLKSDDLPLSDINIALDALAEGQAVR
QILRPGVSA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaattcgtagtgcggtgctgcacgcggcaccgatcgaaaggccgtaccgcgacacc
cacccgctgaaagtcattgagctagaactcgacccgccgggccccggcgaggtgctggta
cgcatcgaagccgcgggcctgtgccactcggatctgtcggtggtcgacgggaaccggata
cgtccggtacccatggcactcggacacgaggcggccggtgtcatcgccgcggtgggcccc
ggcgtacgcgacgtctcccccggtgatcatgtggtgctggtgtatgtaccgagctgcggc
gcgtgcaggtactgctcatccggtcgcccggcgctatgcccggacgccgccgcggcgaac
ggccgcggtgacctgatccgcggcggcacccggctgcacgatctggacggcaccgaggta
cgtcaccatcttggtgtctccgggttcgccgatcatgctgtggtggatcgcaattcggtg
gtcgtcatcgatgagaacgttcctctcgacaccgctgccctctttggctgcgccatgctc
accggctttggcgcggttacccacaccgcgtccgtgcgccccggagactccgtggcggtc
ctcggattgggtggcgtcggtctggccgtggtgatgtcggcggccgccgccggcgcgggt
gaggtactggctatcgaccccgtgcccgccaaacgcgaactcgcccttgagctcggcgcc
accagcgcctgcgcgccggatgaagcccccggcggacatgactgggtgttcgaggtggtc
ggttcggccgccgtgctggagcaggcctacgcgctcaccgggcgcggcggcggcaccgtg
tcggtgggcctaccgcatcccgatgcacgaatcagcctgcccgcgttgaatatcgtcgcg
gagggccgcagcatcctgggctcatacatgggttcggcgcaaccgcaacaggacatcccg
gccatgctggcgctgtggcgggcggggcgcctgccagtggagaagctcaagtccgatgac
ctgccgttgtccgatatcaatatcgcgctcgacgcccttgccgagggccaggcggtgcgt
cagatcctgcgcccgggagtgagcgcgtga

DBGET integrated database retrieval system