KEGG   Mycobacterium abscessus ATCC 19977: MAB_1038Help
Entry
MAB_1038          CDS       T00657                                 

Definition
Putative formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mab00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MAB_1038
Enzymes [BR:mab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MAB_1038
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MAB_1038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1047655..1048518
Genome map
AA seq 287 aa AA seqDB search
MPELPEVEALADHLRRHATGATIGRIDISALSVLKTFDPPITALHGQPVTGATRWGKYLG
LQAGDLYLVTHLSRAGWLRWSDKLAAAPLKPGKGPIALRVHLGTPGDAPGFDLTEAGTQK
RLAVWVVRDPAAVPQIASLGPDALSLTADGLADILAGTTARLKNVITDQRVISGIGNAYS
DEILHVAKLSPFASGKTLSEGQLTALYEAMQSVLTDAVERSVGQQAATLKGEKRSGLRVH
ARAGMPCPVCGDVVREVSFADKSFQYCPTCQTGGKVLADRRLSRLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactaccggaagtcgaggcgctcgcggatcacctgcgccgccacgccaccggg
gccaccatcggccgcatcgatatctcggccctgtccgtgctcaagaccttcgatccgccg
atcaccgctttgcacggtcagccggtgacgggtgcgactcgctggggcaagtatctggga
ctgcaagcaggggatctgtatctcgtcacgcacctgtcccgtgcggggtggttgcgctgg
tcggacaagctggcggcggcaccccttaagccgggaaagggccccatcgcgctgcgggtg
cacctcggaacacctggtgatgcgccaggattcgatctcacggaggccggcacccaaaaa
cggttggccgtgtgggtggtgcgagatcccgccgcggtgccgcagatagcgtccctgggg
cccgacgcgctctctctcactgccgacgggctggccgacatattggccgggaccactgcg
cgcctgaagaacgtgatcaccgaccaacgggtgatctccggaatcggcaacgcctacagc
gacgagatcctgcatgtggccaagctgtcacccttcgccagcggaaaaacgctgtccgaa
gggcaactgaccgcattgtacgaggcgatgcagtcggtgctcaccgatgcggtagagcgt
agcgtcggacaacaggcggcaactcttaagggggagaagcgatccgggttgcgggtgcat
gcccgcgccgggatgccctgcccggtgtgtggcgatgtggtgcgggaggtgtcattcgcc
gataagtcgttccagtattgcccgacctgccagaccggtggcaaggtgctagccgaccgt
cggctctcgcgactgctcaaataa

DBGET integrated database retrieval system