KEGG   Mycobacterium abscessus ATCC 19977: MAB_1056Help
Entry
MAB_1056          CDS       T00657                                 

Definition
(RefSeq) Succinyl-CoA synthetase, beta chain
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAB_1056
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAB_1056
   00640 Propanoate metabolism
    MAB_1056
   00660 C5-Branched dibasic acid metabolism
    MAB_1056
Enzymes [BR:mab01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MAB_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1065715..1066884
Genome map
AA seq 389 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTTTAEDAKAIAEEIGKPVMIKAQVKVGGRGKAGGVK
YAATPDDALTHAQNILGLDIKGHIVKKILVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGVEIEVTAEENPDALAKVPVDAVKGVDLALAREIAEKGKLPAEVLDSAAVTIQKLWEVF
VGEDATLVEVNPLVRTPDNQILALDGKVTLDGNADFRQPGHAEFEDKDATDPLELKAKEH
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGENHNGVKPANFLDIGGGASAEVMAAGLD
VILGDSQVKSVFVNVFGGITACDAVANGIVGALKTLGNTASKPLVVRLDGNKVEEGRAIL
AEFNHPLVIQAETMDAGADKAAALAAASN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttcgagtaccaggccaaggagctgttcgctaagcacaatgtgccgacgacg
ccgggccgggttaccaccaccgccgaggatgccaaggcgatcgccgaagaaatcggcaag
ccggtgatgatcaaggctcaggtcaaggttggcggacgtggcaaggccggtggtgtgaag
tacgccgccacccccgatgacgctcttactcacgcacagaacattctgggcctggacatc
aagggccacatcgtcaagaagatcctcgtcgccgaggccagcgatatcgccgaggagtac
tacatctccttcctgctggaccgtgccaaccgcacctacctggccatgtgctcggtcgag
ggcggtgtcgagatcgaggtaaccgccgaggagaaccccgacgcactggccaaggtgccc
gttgacgccgtcaagggtgtcgacctggcgctggctcgtgagattgccgagaagggcaag
ttgcccgccgaggtactggactccgccgcggtgaccatccagaagctgtgggaggtcttc
gtcggcgaggatgccaccctggtggaggtcaacccgctggtgcgcacccccgacaatcag
atcctggcgctggacggcaaggtcaccctggacggcaacgccgatttccgtcagcccggc
catgccgagttcgaggacaaggacgccaccgatccgctggaactcaaggccaaggagcac
gacctcaactacgtcaagctcgatggtcaggtcggcatcatcggcaacggcgcaggtctg
gtcatgtccaccctggatgtcgtcgcgtatgcgggcgagaaccacaacggcgtgaagcct
gccaacttcctggatatcggtggtggcgcctcggccgaggtgatggctgccggtcttgat
gtcatcctgggtgactcgcaggtcaagagcgtttttgtgaacgtgttcggtggcatcacc
gcatgtgacgcggtggctaacggcatcgtcggcgccctgaagactctcggtaacacggcc
agcaagccgttggtggttcgtctcgacggcaacaaggtcgaagaaggacgggcgattctg
gccgagttcaatcatccgctggtgatccaggccgagaccatggacgccggtgccgacaag
gcggccgccctggcggccgcatccaactag

DBGET integrated database retrieval system