KEGG   Mycobacterium abscessus ATCC 19977: MAB_1086Help
Entry
MAB_1086          CDS       T00657                                 

Definition
Putative UTP-glucose-1-phosphate uridylyltransferase (GalU)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mab00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mab00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mab00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mab00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1098371..1099300
Genome map
AA seq 309 aa AA seqDB search
MTGPDVLIPRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAEEAAEAGAERLVI
VTSEGKDGVVAHFVEDLVLEGTLEARGKHAMLEKVRKAPALIKVQSVVQAEPLGLGHAVG
CVESVLDDDEDAVAVLLPDDLVWPRGVLETMAKVRAKRGGSVLCAIEVPPHEISSYGAFD
VEIVPDAANPNVLRVKGMVEKPKTEEAPSNYAAAGRYLLDRAIFDALKRIPRGAGGELQL
TDAIALLIDEGHPVHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPGLREWLVERLGR
ESSVLPESE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacgggacctgacgtgttgattccccgaaccgcggttgtgcccgcggcgggcctgggc
acccggttcctgccggccaccaagacggtgcccaaggagctgcttccggtggtcgacacc
cccggaatcgaactggtggccgaggaggccgccgaggccggcgccgaacgtttggtgatc
gtcacctccgagggcaaggacggcgtcgtcgcgcacttcgtcgaagacttggtgctggaa
ggcacactcgaggcgcgcggtaaacacgccatgctcgaaaaggtgcgcaaggctccggcg
ctcatcaaggtgcagtcggtggtgcaggccgagccgttggggctggggcatgcggtggga
tgcgtggagtcggttctcgacgacgacgaggatgccgtcgcggtgctgctgccggacgat
ctggtgtggccgcgcggcgtgctggagaccatggccaaggtgcgggccaaacgcggcggc
tcggtgctgtgcgccatcgaggtgcccccgcacgagatcagctcctacggtgcgttcgat
gtcgagatcgtgcccgacgccgcgaacccgaatgttctgcgcgtcaagggaatggtcgag
aagccaaagaccgaggaagcaccctcgaactacgcggcggccggccgctacctgctggat
cgcgcgattttcgacgcgctcaagcggatcccgcgcggggccggcggcgagctgcagctc
accgacgccatcgctttgttgatcgacgaggggcatccggtgcatgttgtggtgcaccgc
ggatcccgacacgacctgggaaatcccggcggctatctcaaggctgctgttgactttgcg
ttggatcgcgacgattacggtccgggcttgcgggagtggctggtcgagcggctcggccgg
gaatcgtccgtgctgccggagtcggagtaa

DBGET integrated database retrieval system