KEGG   Mycobacterium abscessus ATCC 19977: MAB_1139Help
Entry
MAB_1139          CDS       T00657                                 

Definition
Probable 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MAB_1139
Enzymes [BR:mab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MAB_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1154427..1155371
Genome map
AA seq 314 aa AA seqDB search
MSETVSDWVPTGAVTVRAPGKVNLYLAVGDLRDDGYHELTTVFHAVSLADDVTVRDADVL
SIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAA
VLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVF
AFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVS
LNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASG
PVHGAQVIQGRSDG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgagaccgtctccgattgggttcctaccggcgcggtgactgtccgggcacccggc
aaggtcaatctgtacctggccgtaggtgacctccgtgacgacggctatcacgagctgacc
acggtttttcacgccgtttcgctggccgacgacgtgaccgtgcgggacgccgacgtgtta
tcgatcgatgtggtcgggcagggcgagggcacggtgcccaccgacgaacgcaatctcgcc
tggcaggccgccgagcttttcgccgatcacgtgggccgcgcccccgacgtctcgatcttc
attaacaaggacatccccgtcgcgggcggtatggccggcggatccgccgatgccgctgcg
gtgttggtggcgatgaacgagctctggcatgccggtgtgccgcgccgggacctgcaccac
ctggccgctcaactgggcagcgatgtcccctttgccttacatggcggcaccgcgctgggc
actggccggggtgagcagctggcgaccgtattggcgcgcaatgtctttcattgggtgttc
gccttcgccgacgggggactggcgacgcctcaggtcttcaaggagatcgaccggttgcgt
gagaacggcgatccgccgcggctcgccgaggcggatgagcttttgggtgcgctcgccgcc
ggggacgcgcgccggctggcgccgctgctcggtaacgaattgcaggccgcggcggtcagc
ctgaaccccgaattgcggcgcacgctgcgggcaggggagtcggccggcgccctggctgga
atcgtctccggatcgggccccacctgtgcgttcttgtgcacctcggccgacgatgcggtg
caggtgagtgcggagctggcgggcgcgggggtgtgccgcaccgtgcgggtggccagcgga
cccgtgcacggcgcacaggtcatccagggccgcagtgacggctga

DBGET integrated database retrieval system