KEGG   Mycobacterium abscessus ATCC 19977: MAB_1139Help
Entry
MAB_1139          CDS       T00657                                 

Definition
Probable 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mab00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1154427..1155371
Genome map
AA seq 314 aa AA seqDB search
MSETVSDWVPTGAVTVRAPGKVNLYLAVGDLRDDGYHELTTVFHAVSLADDVTVRDADVL
SIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAA
VLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVF
AFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVS
LNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASG
PVHGAQVIQGRSDG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgagaccgtctccgattgggttcctaccggcgcggtgactgtccgggcacccggc
aaggtcaatctgtacctggccgtaggtgacctccgtgacgacggctatcacgagctgacc
acggtttttcacgccgtttcgctggccgacgacgtgaccgtgcgggacgccgacgtgtta
tcgatcgatgtggtcgggcagggcgagggcacggtgcccaccgacgaacgcaatctcgcc
tggcaggccgccgagcttttcgccgatcacgtgggccgcgcccccgacgtctcgatcttc
attaacaaggacatccccgtcgcgggcggtatggccggcggatccgccgatgccgctgcg
gtgttggtggcgatgaacgagctctggcatgccggtgtgccgcgccgggacctgcaccac
ctggccgctcaactgggcagcgatgtcccctttgccttacatggcggcaccgcgctgggc
actggccggggtgagcagctggcgaccgtattggcgcgcaatgtctttcattgggtgttc
gccttcgccgacgggggactggcgacgcctcaggtcttcaaggagatcgaccggttgcgt
gagaacggcgatccgccgcggctcgccgaggcggatgagcttttgggtgcgctcgccgcc
ggggacgcgcgccggctggcgccgctgctcggtaacgaattgcaggccgcggcggtcagc
ctgaaccccgaattgcggcgcacgctgcgggcaggggagtcggccggcgccctggctgga
atcgtctccggatcgggccccacctgtgcgttcttgtgcacctcggccgacgatgcggtg
caggtgagtgcggagctggcgggcgcgggggtgtgccgcaccgtgcgggtggccagcgga
cccgtgcacggcgcacaggtcatccagggccgcagtgacggctga

DBGET integrated database retrieval system