KEGG   Mycobacteroides abscessus ATCC 19977: MAB_1318cHelp
Entry
MAB_1318c         CDS       T00657                                 

Definition
(RefSeq) Probable catechol-o-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00350  Tyrosine metabolism
mab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MAB_1318c
Enzymes [BR:mab01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MAB_1318c
Exosome [BR:mab04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MAB_1318c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_16
Motif
Other DBs
NCBI-GeneID: 5963842
NCBI-ProteinID: YP_001702060
UniProt: A0A2C9Y6K1
Position
complement(1318979..1319740)
Genome map
AA seq 253 aa AA seqDB search
MSLTRTLKQKLPFLRYSFLRAVFGGLNVMRTGQMGDGREEATAEHVVATAPAGDIDAAIE
AIDNFAYDQSILMNVGDEKGQLLDAAVKRANPKIALELGAYCGYSGLRIARAAPGAKFFS
IEKSGANASVARRVWAHAGLADRATCLTGTADDGVTLDTLAKDYGFTEGCLDFVFIDHWK
DIYLDDLQRLLERGWLHPGTIVVADNVRFPGAPKYRAYMKDQQGKLWQTIEHETHVEYQT
LVKDLVLESEYLG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcttacgagaaccctcaagcagaaactcccatttctgcggtattcgtttctgcgg
gcggtgttcggcggcctcaacgtcatgcgcaccggtcagatgggcgatggtcgcgaggaa
gccaccgccgagcatgtcgtcgcgaccgccccggccggggatatcgacgccgccatcgag
gcgatcgacaacttcgcgtacgaccagtcgattctcatgaacgtcggcgacgaaaagggc
cagctgctcgatgccgccgtcaaacgcgccaaccccaagatcgccctggagctgggcgcc
tattgcggctacagcggcctacggatcgcgcgggcggccccgggcgccaaattcttctcc
atcgagaaatcaggcgccaacgcctccgtggcacgccgagtctgggcacacgccggtctg
gcggatcgggccacctgtctcaccgggacggccgatgacggcgtcaccttggacaccttg
gccaaggactacgggtttaccgagggatgtctggatttcgtgttcatcgaccattggaag
gacatttatctcgatgacctgcagcggcttctggaacggggctggctgcatccgggcacg
atcgtcgtcgccgataacgtccgcttccccggcgctccgaagtaccgcgcgtacatgaag
gaccagcagggcaagctctggcagaccatcgagcacgagacccacgtggagtatcagact
ctggtgaaggatctggtgctggagtcggagtacctgggatag

DBGET integrated database retrieval system