KEGG   Mycobacterium abscessus ATCC 19977: MAB_1336Help
Entry
MAB_1336          CDS       T00657                                 

Definition
Probable succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAB_1336
  Amino acid metabolism
   00300 Lysine biosynthesis
    MAB_1336
Enzymes [BR:mab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MAB_1336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1337877..1338941
Genome map
AA seq 354 aa AA seqDB search
MALELAGDPIALTAALVDIPSESRHEAQIADAVEVALREQTSGFEVIRNGNAVLARTNNG
LGTRVMLAGHLDTVPAADNVPSRHEGEILHGCGTVDMKSGDAVFLHLAATVTPRVDLTLV
FYDCEEIESSANGLGRIERELPDWLDADLAILGEPTAGLIEAGCQGTLRVVIRTRGTRAH
SARSWLGDNAIHKLAAVLDRLAAYRARIVDIDGCQYREGLSAVRIDGGVAGNVIPDEAAV
TVNFRFAPDRSPEQALVHVHEVFDGLDVQIELTDSAAGALPGLDRPAAAELVGAAGGVVR
AKYGWTDVSRFAARGIAAVNYGPGDPNLAHTRGEHVPVQQITAVTEVLRRYLTV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcttgaactcgctggtgacccgatcgccctgacggctgccctggtagacatcccc
agtgagtcccgtcacgaggcccagatcgccgatgcggtcgaggtggcgctgcgggaacag
accagtggtttcgaggtcatccgtaacggcaacgcggtgctggcccgtacgaataacggg
ctcggtacccgggtcatgctggccgggcacctggataccgtgcccgccgccgataacgtg
cccagcaggcacgagggagagatcctgcacggctgcggcaccgtcgacatgaaatccggg
gacgccgtattcctgcatctggccgccaccgtgacaccccgggtggaccttacgctggtg
ttctacgactgcgaggagatcgagtcctcggccaacgggctgggccgcatcgaacgcgaa
ctgcccgactggctcgacgcagacctggccatcctgggcgagccgaccgccggactcatc
gaagcgggctgtcagggcaccctgcgggtcgtcatccggaccaggggcacccgcgcgcac
tcggcgagatcctggctgggggacaacgccattcacaaactggccgctgtactggacagg
ctggccgcttaccgggcgcgcatcgtcgatatcgatggctgtcagtatcgggaaggatta
tccgcggtacggatcgatggcggagtcgccgggaacgtgattcccgatgaggcggcggtc
actgtgaatttccggttcgctcccgatcgcagccccgagcaggcgctcgtgcacgtgcat
gaggtattcgacgggctcgatgtccagatcgaactcaccgactcggccgccggagcgctg
cccggcctggaccgccccgccgccgccgaattggtcggtgcggcagggggagtggtgcgg
gcgaagtatggctggaccgacgtgtcccggttcgcggcgcgcggtatcgccgcggtcaac
tacgggcccggcgatcccaacttggcacatacccgcggcgaacacgttcccgtccagcag
atcaccgccgtcaccgaggtacttcggcgttatctcaccgtgtga

DBGET integrated database retrieval system