KEGG   Mycobacterium abscessus ATCC 19977: MAB_1345Help
Entry
MAB_1345          CDS       T00657                                 

Definition
Probable dihydropteroate synthase 2 FolP2
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MAB_1345
Enzymes [BR:mab01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MAB_1345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1346566..1347474
Genome map
AA seq 302 aa AA seqDB search
MARRAALHNEDVRETFCGRPVRTDRALIMAIVNRTPDSFYDRGATFTDEAAQAAVHQAVA
DGADVVDIGGVKAGPGENVDADAEIARVVPFIEWVRGAHPDLLISVDTWRAEVAAKACAA
GADLINDTWAGADPELPAVAAAYGAGLVCSHTGGAVPRTRPYRVHYGTEVDGVVRAVLDE
VTASAERALALGVSKDAILIDPTHDFGKNTFHGLALLRHVNDLVNTGWPVLMALSNKDFI
GETLGVGLTERLEGTLAATALAAAAGARMFRVHEVGPTRRTLEMVGSIVGTRPPARTVRG
LA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggcgggctgccctgcacaatgaggacgtgcgtgagacgttttgtggacgaccc
gtccgcaccgatcgtgcgctcatcatggcgatcgtgaaccgcacaccggactcgttctat
gaccgcggcgccacctttaccgacgaggcggcgcaggcggcggtgcatcaagcggtggcc
gatggtgcggatgtcgtcgacatcggtggcgtcaaggcgggcccgggggagaacgtcgac
gccgacgccgaaatcgcgcgggtggtgcccttcatcgaatgggtgcgcggcgcccacccc
gacttgctgatcagcgtggatacctggcgcgccgaggttgcggcgaaggcctgtgcggca
ggagccgatctgatcaacgacacctgggcgggtgccgatcccgagctaccggccgtggcg
gccgcgtacggcgccggattggtttgctcccacaccggtggcgcggtaccgcgtacccgg
ccgtatcgcgtccattacggaaccgaggtcgacggcgtcgtgcgggcggtgctcgacgaa
gtgaccgcgtccgccgagcgggcgctcgccctgggggtgtcgaaggacgcgattctgatc
gatccgacgcatgacttcggcaaaaacaccttccacgggctcgctttgttgcgccacgta
aacgatctcgttaataccgggtggcccgtgttgatggcgttgagcaacaaggatttcatc
ggggagactcttggtgtgggactgacggaacgactcgagggcaccctcgccgccaccgca
ctggcggctgctgcgggtgctcgcatgttccgggttcatgaggtcgggcccacacgccgc
acgctggaaatggtgggctccatcgtcgggacccgcccaccggcgcgaacagtgaggggg
ttggcatga

DBGET integrated database retrieval system