KEGG   Mycobacterium abscessus ATCC 19977: MAB_1436Help
Entry
MAB_1436          CDS       T00657                                 

Definition
(RefSeq) Probable threonine synthase (ThrC)
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
mab00260  Glycine, serine and threonine metabolism
mab00750  Vitamin B6 metabolism
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01120  Microbial metabolism in diverse environments
mab01230  Biosynthesis of amino acids
Module
mab_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAB_1436
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MAB_1436
Enzymes [BR:mab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MAB_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 5963958
NCBI-ProteinID: YP_001702176
UniProt: A0A2C9Y6W3
Position
1441182..1442249
Genome map
AA seq 355 aa AA seqDB search
MTVHTPWPGLIAAYRDRLPIGENWQPVTLREGGTPLLPAARLSELTGCTVHLKVEGLNPT
GSFKDRGMTMAVTDALARGQRAVLCASTGNTSASAAAYAAKAGITCAVLIPQGKIAMGKL
AQAVIHGARIIQVDGNFDDCLELARKTTADYPTIALVNSVNPVRIEGQKTAAFEIVDALG
TAPDIHALPVGNAGNITAYWRGYNEYHRDGLSDRLPKMLGAQAAGAAPLVNGAPVANPET
IATAIRIGSPASWSGAVAAQQESGGKFLAVTDEEILNAYRLVASSEGVFVEPASAASIAG
LLKSVADGWVAKGSTVVCTVTGNGLKDPDNALSGMPEVTPIPVQASAVAEALELA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgacagttcataccccgtggcccggcctcatcgccgcttaccgcgaccgtctcccgatc
ggtgagaactggcagccagtgaccctgcgtgagggcggtacgccgttgctccccgcggct
cgtctctccgagctcaccggatgcaccgtgcacctgaaggtcgaaggcctgaaccccacc
gggtcgttcaaggaccgcggtatgaccatggccgtgaccgacgcgctggcgcgtggccag
cgcgcggtgctgtgtgcctcgaccgggaacacctccgcctcggccgccgcatatgcggcc
aaggcgggtatcacgtgtgctgtattgattccgcagggcaagatcgcgatgggcaagttg
gcccaggccgttatccacggtgcgcggatcatccaggtagacggcaattttgatgactgt
ctggagctggcgcgcaagaccacggcggattatccgaccattgcgctggtgaactcggtg
aatccggtgcgtatcgaggggcagaagactgctgccttcgagatcgtggatgcgctcggc
accgcccccgatatccatgcgctgccggtcggcaacgccgggaacatcaccgcgtactgg
cgcggctacaacgagtaccaccgtgacggtctgtcggaccgcctgcccaagatgctgggt
gctcaggctgccggcgccgcaccgctggtcaacggggcgcctgtcgccaatccggagacc
atcgccaccgccatccggatcggatctcctgcttcgtggtcgggcgcggttgccgcgcaa
caggaatcgggcggcaagttcctggccgtcaccgatgaggagattctcaacgcctaccgg
ctggtcgcatccagcgaaggcgtgttcgtggagcccgcgtcggcagccagcatcgcgggc
ctgctgaaatcggtcgcagacggctgggttgccaagggttccaccgtggtctgcaccgtg
acgggcaacggcctgaaggatcccgacaatgcgctgagcggaatgcccgaggtgactccc
atcccggtccaggcgagtgccgtcgccgaggcgctggaactggcgtga

DBGET integrated database retrieval system