KEGG   Mycobacterium abscessus ATCC 19977: MAB_1436Help
Entry
MAB_1436          CDS       T00657                                 

Definition
(RefSeq) Probable threonine synthase (ThrC)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAB_1436
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAB_1436
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MAB_1436
Enzymes [BR:mab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MAB_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1441182..1442249
Genome map
AA seq 355 aa AA seqDB search
MTVHTPWPGLIAAYRDRLPIGENWQPVTLREGGTPLLPAARLSELTGCTVHLKVEGLNPT
GSFKDRGMTMAVTDALARGQRAVLCASTGNTSASAAAYAAKAGITCAVLIPQGKIAMGKL
AQAVIHGARIIQVDGNFDDCLELARKTTADYPTIALVNSVNPVRIEGQKTAAFEIVDALG
TAPDIHALPVGNAGNITAYWRGYNEYHRDGLSDRLPKMLGAQAAGAAPLVNGAPVANPET
IATAIRIGSPASWSGAVAAQQESGGKFLAVTDEEILNAYRLVASSEGVFVEPASAASIAG
LLKSVADGWVAKGSTVVCTVTGNGLKDPDNALSGMPEVTPIPVQASAVAEALELA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgacagttcataccccgtggcccggcctcatcgccgcttaccgcgaccgtctcccgatc
ggtgagaactggcagccagtgaccctgcgtgagggcggtacgccgttgctccccgcggct
cgtctctccgagctcaccggatgcaccgtgcacctgaaggtcgaaggcctgaaccccacc
gggtcgttcaaggaccgcggtatgaccatggccgtgaccgacgcgctggcgcgtggccag
cgcgcggtgctgtgtgcctcgaccgggaacacctccgcctcggccgccgcatatgcggcc
aaggcgggtatcacgtgtgctgtattgattccgcagggcaagatcgcgatgggcaagttg
gcccaggccgttatccacggtgcgcggatcatccaggtagacggcaattttgatgactgt
ctggagctggcgcgcaagaccacggcggattatccgaccattgcgctggtgaactcggtg
aatccggtgcgtatcgaggggcagaagactgctgccttcgagatcgtggatgcgctcggc
accgcccccgatatccatgcgctgccggtcggcaacgccgggaacatcaccgcgtactgg
cgcggctacaacgagtaccaccgtgacggtctgtcggaccgcctgcccaagatgctgggt
gctcaggctgccggcgccgcaccgctggtcaacggggcgcctgtcgccaatccggagacc
atcgccaccgccatccggatcggatctcctgcttcgtggtcgggcgcggttgccgcgcaa
caggaatcgggcggcaagttcctggccgtcaccgatgaggagattctcaacgcctaccgg
ctggtcgcatccagcgaaggcgtgttcgtggagcccgcgtcggcagccagcatcgcgggc
ctgctgaaatcggtcgcagacggctgggttgccaagggttccaccgtggtctgcaccgtg
acgggcaacggcctgaaggatcccgacaatgcgctgagcggaatgcccgaggtgactccc
atcccggtccaggcgagtgccgtcgccgaggcgctggaactggcgtga

DBGET integrated database retrieval system