KEGG   Mycobacterium abscessus ATCC 19977: MAB_1436Help
Entry
MAB_1436          CDS       T00657                                 

Definition
Probable threonine synthase (ThrC)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAB_1436
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAB_1436
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MAB_1436
Enzymes [BR:mab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MAB_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1441182..1442249
Genome map
AA seq 355 aa AA seqDB search
MTVHTPWPGLIAAYRDRLPIGENWQPVTLREGGTPLLPAARLSELTGCTVHLKVEGLNPT
GSFKDRGMTMAVTDALARGQRAVLCASTGNTSASAAAYAAKAGITCAVLIPQGKIAMGKL
AQAVIHGARIIQVDGNFDDCLELARKTTADYPTIALVNSVNPVRIEGQKTAAFEIVDALG
TAPDIHALPVGNAGNITAYWRGYNEYHRDGLSDRLPKMLGAQAAGAAPLVNGAPVANPET
IATAIRIGSPASWSGAVAAQQESGGKFLAVTDEEILNAYRLVASSEGVFVEPASAASIAG
LLKSVADGWVAKGSTVVCTVTGNGLKDPDNALSGMPEVTPIPVQASAVAEALELA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgacagttcataccccgtggcccggcctcatcgccgcttaccgcgaccgtctcccgatc
ggtgagaactggcagccagtgaccctgcgtgagggcggtacgccgttgctccccgcggct
cgtctctccgagctcaccggatgcaccgtgcacctgaaggtcgaaggcctgaaccccacc
gggtcgttcaaggaccgcggtatgaccatggccgtgaccgacgcgctggcgcgtggccag
cgcgcggtgctgtgtgcctcgaccgggaacacctccgcctcggccgccgcatatgcggcc
aaggcgggtatcacgtgtgctgtattgattccgcagggcaagatcgcgatgggcaagttg
gcccaggccgttatccacggtgcgcggatcatccaggtagacggcaattttgatgactgt
ctggagctggcgcgcaagaccacggcggattatccgaccattgcgctggtgaactcggtg
aatccggtgcgtatcgaggggcagaagactgctgccttcgagatcgtggatgcgctcggc
accgcccccgatatccatgcgctgccggtcggcaacgccgggaacatcaccgcgtactgg
cgcggctacaacgagtaccaccgtgacggtctgtcggaccgcctgcccaagatgctgggt
gctcaggctgccggcgccgcaccgctggtcaacggggcgcctgtcgccaatccggagacc
atcgccaccgccatccggatcggatctcctgcttcgtggtcgggcgcggttgccgcgcaa
caggaatcgggcggcaagttcctggccgtcaccgatgaggagattctcaacgcctaccgg
ctggtcgcatccagcgaaggcgtgttcgtggagcccgcgtcggcagccagcatcgcgggc
ctgctgaaatcggtcgcagacggctgggttgccaagggttccaccgtggtctgcaccgtg
acgggcaacggcctgaaggatcccgacaatgcgctgagcggaatgcccgaggtgactccc
atcccggtccaggcgagtgccgtcgccgaggcgctggaactggcgtga

DBGET integrated database retrieval system