KEGG   Mycobacterium abscessus ATCC 19977: MAB_1457Help
Entry
MAB_1457          CDS       T00657                                 

Definition
Probable UDP-N-acetylglucosamine 1-carboxyvinyltransferase MurA
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mab00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mab00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1460413..1461651
Genome map
AA seq 412 aa AA seqDB search
MVTGGARLTGNVAVTGAKNSVLKLMAAALLAEGTSTITNCPDILDVPLMAEVLRGLGATV
ELEGDVVRITSPDEPKYDADFAAVRQFRASVCVLGPLVGRCRRAKVALPGGDAIGSRPLD
MHQAGLRQLGAECTIEHGCVVAEAKALHGADIHLEFPSVGATENILMAAVLADGVTTIHN
AAREPDVVDLCTMLVQMGAEIEGAGTSTLTVTGVSALHPTEHRVIGDRIVAATWGLAAAM
TRGDVTVTGVDPEHLQLVLHKLHDAGATVTQSDDGFRVVQYERPKAINVATLPFPGFPTD
LQPMAIGLAAIADGTSMITENVFEARFRFVEEMMRLGADARTDGHHAVVRGIRQLSSAPV
WSSDIRAGAGLVLAGLVADGVTEVYDVFHIDRGYPLFVENLQSLGAEVERVS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttggtaaccggcggcgcccggctgacaggcaacgtggcagtgaccggcgccaagaacagc
gtgctcaagctgatggcggcagctcttctagccgaggggaccagcaccatcaccaactgt
ccggacatcctggacgtgccgctcatggctgaggtgctgcgcggattgggcgcgacggtc
gagttggaaggcgatgtagtcaggatcacttcgcccgacgagccgaagtatgacgcggac
ttcgccgcagtcaggcagttccgtgcctcggtctgtgtcctcggacctctggtgggccga
tgccggagggccaaggtcgcgctacctggcggggatgcgatcggatcacgaccgcttgat
atgcatcaggcggggctgcggcagctcggcgcggagtgcaccattgagcacggctgcgtg
gttgcggaggcaaaagccttacacggagccgatattcatcttgagtttccgtcggtgggc
gccaccgagaacatcttgatggcagcggtgctcgctgacggcgtgacgaccatccacaac
gcggcacgtgaacccgacgtggtcgacctgtgcaccatgctggtgcagatgggggccgag
atcgagggagcgggaacgtcgacgctgacagtaaccggtgtttccgcgcttcatcccacc
gagcatcgcgtcattggagaccgaatcgtcgctgccacttggggtctcgctgcggcgatg
acgcgcggcgatgtcacggtcacgggcgtggatccggagcacttgcagttggtactgcac
aagttgcacgatgctggggcgacagtcacgcagagcgacgacggtttccgtgtcgtgcag
tacgagcgcccgaaggcgatcaacgtcgccacgctgccgttcccaggattcccaactgac
ttgcagcccatggcaattgggctagcggccatagctgacggcacatccatgatcaccgaa
aacgtcttcgaggcccgcttccgttttgtcgaagagatgatgcgtttaggggccgacgcg
cgaaccgatgggcatcacgcagtggttcggggtatccggcaactgtccagcgctccggtg
tggtcgtcggatattcgggccggcgcgggtctggtactggcgggtctagtggcggacggc
gtcacagaggtatacgatgtgtttcatatcgaccgcggttacccgttgttcgtggagaat
ctccagagcttgggtgccgaagtcgagcgggtcagctag

DBGET integrated database retrieval system