KEGG   Mycobacterium abscessus ATCC 19977: MAB_1472cHelp
Entry
MAB_1472c         CDS       T00657                                 

Definition
Putative nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MAB_1472c
Enzymes [BR:mab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     MAB_1472c
    3.5.1.-  
     MAB_1472c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1486415..1486969)
Genome map
AA seq 184 aa AA seqDB search
MGRALIVVDVQNDFCEGGSLSVPGGAALARTLNHLTRSGAYDAVVATRDFHVDPGGHFSE
NPDFQTSWPPHCRAGTPGADFHPYLDMGPVDEVFSKGAYSAAYSGFEGVATDGTALAAWL
HSRELNDVDVVGIATDYCVAATARDAAHEGLHTRVLTAYSVGISEESVNRALDELQRAGV
EVIR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgggcagggcgcttatcgtcgtcgacgtgcagaacgacttctgcgagggaggctcgctg
tccgtgcccggcggcgccgccctggcccggacactgaaccacctcacccgctcgggcgcc
tatgacgcggtggtggcgacccgggactttcacgtcgaccccggcggccacttttcggag
aatccggacttccagacgagctggccaccacattgccgggccggcacacccggcgcggac
tttcatccctatctggatatgggccccgtcgacgaggtgttttccaaaggtgcgtacagc
gcggcatactcgggattcgagggcgtcgccaccgacggcaccgcactggcagcctggctg
cacagccgggaactgaatgacgtcgacgtggtgggcatcgccaccgactactgcgttgcc
gcgaccgcccgcgacgcggcgcacgagggactgcatactcgcgtgcttaccgcctattcc
gttggcatctctgaggaatcggtgaatcgcgccctggacgagctccagcgcgccggcgtc
gaggtgatccgctga

DBGET integrated database retrieval system