KEGG   Mycobacteroides abscessus ATCC 19977: MAB_1472cHelp
Entry
MAB_1472c         CDS       T00657                                 

Definition
(RefSeq) Putative nicotinamidase/pyrazinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00760  Nicotinate and nicotinamide metabolism
mab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MAB_1472c
Enzymes [BR:mab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     MAB_1472c
    3.5.1.-  
     MAB_1472c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase HTH_Crp_2 RPA_C
Motif
Other DBs
NCBI-GeneID: 5963993
NCBI-ProteinID: YP_001702212
UniProt: A0A0S1T0Y9
Position
complement(1486415..1486969)
Genome map
AA seq 184 aa AA seqDB search
MGRALIVVDVQNDFCEGGSLSVPGGAALARTLNHLTRSGAYDAVVATRDFHVDPGGHFSE
NPDFQTSWPPHCRAGTPGADFHPYLDMGPVDEVFSKGAYSAAYSGFEGVATDGTALAAWL
HSRELNDVDVVGIATDYCVAATARDAAHEGLHTRVLTAYSVGISEESVNRALDELQRAGV
EVIR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgggcagggcgcttatcgtcgtcgacgtgcagaacgacttctgcgagggaggctcgctg
tccgtgcccggcggcgccgccctggcccggacactgaaccacctcacccgctcgggcgcc
tatgacgcggtggtggcgacccgggactttcacgtcgaccccggcggccacttttcggag
aatccggacttccagacgagctggccaccacattgccgggccggcacacccggcgcggac
tttcatccctatctggatatgggccccgtcgacgaggtgttttccaaaggtgcgtacagc
gcggcatactcgggattcgagggcgtcgccaccgacggcaccgcactggcagcctggctg
cacagccgggaactgaatgacgtcgacgtggtgggcatcgccaccgactactgcgttgcc
gcgaccgcccgcgacgcggcgcacgagggactgcatactcgcgtgcttaccgcctattcc
gttggcatctctgaggaatcggtgaatcgcgccctggacgagctccagcgcgccggcgtc
gaggtgatccgctga

DBGET integrated database retrieval system