KEGG   Mycobacterium abscessus ATCC 19977: MAB_1613Help
Entry
MAB_1613          CDS       T00657                                 

Definition
Probable glutamate 5-kinase (ProB)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAB_1613
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MAB_1613
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MAB_1613
Enzymes [BR:mab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MAB_1613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1643600..1644706
Genome map
AA seq 368 aa AA seqDB search
MNPGAQAREAIRSARTVVVKVGTAALTDETGTFSADRMEYLVEVIEGRMKAGSDVVIVSS
GAIAAGMVPLGLTKRPTDLATKQAAASAGQVALIGAWSAAFARYERTVGQVLLTAHDISM
RVHHTNAQRTLDRLTALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALVLLSD
IDGLYDSDPRKGNARFISEVSGPEDLADVIAGPGGSRGTGGMASKLSSALLASDAGVPVL
LASATEAAAALGDGSCGTVFAARPQRMSARKFWVRYAAEATGSLTLDAGAVRAVVASRRS
LLPAGITGVSGRFHGGDVVELRDADGTMVGRGVVAYDVAELATMLGRSTNELPEDLRRPA
VHADDLVT
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccaggtgcgcaggcgcgtgaggccattcgctcggcgcgcaccgtcgtggtgaag
gtcggcaccgccgcactcaccgatgagacggggaccttcagtgccgaccgcatggaatac
ctcgtcgaggtcatcgaaggccggatgaaggctggatccgatgtggtgatcgtgtcctcc
ggggcgatcgcggcgggcatggttccgctcggattgaccaagcgcccaacggatctggcg
accaagcaggcggcggccagcgctggtcaagtggcccttatcggcgcctggagtgcggcc
ttcgcgcgttatgagcgcaccgtgggccaggtgctgctgaccgcccacgacatctcgatg
cgcgtgcaccacaccaacgcgcagcgcaccctcgacagactcaccgcattgcacgcggtt
gccatcgtgaatgagaacgacaccgtggctaccaacgagattcgtttcggagacaatgac
cgcctctcggcgcttgtcgcgcatttggtgggcgccgatgcgctggtgttgctctccgac
atcgatggactctacgattcagacccccgaaaggggaacgcgcgcttcatttctgaggtg
agcggccccgaggacctggccgacgtgatcgccggccctggcggttcgcgtggtactgga
ggaatggcctccaagctctcctcggcgctgctggcttccgacgccggtgtgccggtgctc
ttggcctcggcgacagaggcggcggcggcactgggagacggctcttgcggaaccgttttc
gccgcgcggccgcaacgcatgtccgcccgcaagttctgggtgcgttacgccgccgaggcc
accggttcactgacgctggacgccggcgcggtacgcgcggtcgtggcgtcccggcgttcg
ttgctgcctgccggtatcaccggggtgtccggacgcttccacgggggcgatgtcgttgag
ctccgcgacgcggacggcaccatggtcggccggggtgtcgtcgcctatgacgtagctgaa
ttggcgaccatgctgggccgctccaccaacgaactccccgaggatctacggcgccccgcc
gtgcacgccgacgacctcgtcacctga

DBGET integrated database retrieval system