KEGG   Mycobacterium abscessus ATCC 19977: MAB_1945cHelp
Entry
MAB_1945c         CDS       T00657                                 

Definition
(RefSeq) Probable dihydrolipoamide succinyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAB_1945c
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAB_1945c
  Amino acid metabolism
   00310 Lysine degradation
    MAB_1945c
Enzymes [BR:mab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MAB_1945c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1943280..1944998)
Genome map
AA seq 572 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPAPTSGVLTKIV
AREDDTVEIGGELGVISEAGEAAPAAPAPAPAPAAAPAPEPTPAPAPEATATAAPEPAAE
PPAAAAPAGSGTSVKMPELGESVTEGTVTRWLKKVGDEVGVDEPLVEVSTDKVDTEIPSP
VAGVLLSISANEDDTVAVGGELAVVGAADAAPAAPAAPAAPAPEPAAAPAAAAAPPAPPA
PAPAPAAPAPASTAPAANGAAGDNPYVTPLVRKLAAENNVDLSALSGSGVGGRIRKQDVL
AAAEAAKAPAAAPAPAAPAASAPAAVAPSLAHLRGTTQKANRIRQITAKKTRESLQETAQ
LTQTHEVDVTKIAALRARAKAAFAEREGVNLTFLPFFAKAAVEALKTHPNVNASYNEESK
EITYFDAEHLGIAVDTDQGLLSPVIHNAGDLSLAGLARAIADIAARARSGNLKPDELAGG
TFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIRDDAGNESIGIRSVCYLPLTY
DHRLIDGADAGRFLTTIKHRLEEGAFEADLGL
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgcccgccctcggtgagagcgtgaccgaagggacggtgacg
cggtggctcaagcaagaaggcgacacggtcgaagtcgacgagccattgctcgaggtgtcc
accgacaaggtggacaccgagatcccagctcccacttcgggtgtgttgaccaagatcgtc
gcccgtgaggacgacaccgtcgagatcggcggcgagctcggtgtgatcagcgaggccgga
gaggcggctcccgccgcccccgcccccgcccccgcccccgcagccgcaccggctccggaa
ccgacacccgcaccggcccccgaagccactgctacggctgctcccgaacccgctgccgag
ccgcccgccgccgctgccccggccggctcgggcacctcggtcaagatgcccgagctcggt
gagtccgtcaccgaaggcaccgtgacccgctggctcaagaaggtcggcgacgaggtcggc
gtggacgaaccgctcgtcgaggtgtccaccgacaaggtcgacaccgagattccgtcgccg
gtggccggtgtgctgctcagcatctcggccaacgaggacgacaccgtggccgtgggcggc
gagcttgccgtcgtcggagccgccgacgccgcgcccgcggcccccgcagctcctgcggcg
cccgctcccgagcctgccgcagctcctgccgcggcagcggcaccgcctgctcccccagcc
ccagcccccgcaccggcggccccggctcccgcatcgacggccccggcagcgaacggtgcc
gccggcgacaacccgtacgtgaccccgctcgtgcgcaagctcgccgccgaaaacaacgtg
gacctttccgcgctgtccggcagcggggtgggcggacgcatccgcaagcaggatgtgctg
gccgccgcggaggccgccaaggctccggccgcggctcccgctcccgcggctcccgccgcg
tccgcgcctgcggccgtagcaccgtccctggcgcacctgcgcggaaccacgcagaaggcc
aaccggattcgtcagatcactgccaagaagacgcgcgagtcactgcaggagaccgcccag
ctgacccagacccacgaggtcgacgtcaccaagatcgcggccctgcgcgcccgggccaag
gccgcgttcgccgagcgcgagggtgtgaacctgacgttcctgccgttcttcgccaaggcc
gcggtggaggcactcaagacgcacccgaacgtcaacgcgagctacaacgaggaatccaag
gagatcacctacttcgacgccgagcacctgggcatcgcggtcgacaccgaccaaggcctg
ctctccccggtgatccacaacgccggtgacctgtcgctggccggtctggcgcgcgcgatc
gccgatatcgcggcacgggcccgttccgggaacctcaagcccgacgagctggccggtggc
accttcaccatcaccaacatcggcagccagggcgccttgttcgacacgccgattctggtg
ccgccgcaggccgccatgctcggcaccggcgcgatcgtgaagcgtcccagggttattcgt
gatgacgccggtaacgagtcgatcggtatccggtcggtgtgctacttgccgctgacctac
gatcaccgcctgatcgacggagccgacgcggggcggttcctgacgaccatcaaacaccgt
ctggaagagggggctttcgaggcggacctgggtctgtag

DBGET integrated database retrieval system