KEGG   Mycobacteroides abscessus ATCC 19977: MAB_1945cHelp
Entry
MAB_1945c         CDS       T00657                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00020  Citrate cycle (TCA cycle)
mab00310  Lysine degradation
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01120  Microbial metabolism in diverse environments
mab01130  Biosynthesis of antibiotics
mab01200  Carbon metabolism
Module
mab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAB_1945c
  Amino acid metabolism
   00310 Lysine degradation
    MAB_1945c
Enzymes [BR:mab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MAB_1945c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 5964459
NCBI-ProteinID: YP_001702681
UniProt: A0A2C9Y8C8
Position
complement(1943280..1944998)
Genome map
AA seq 572 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPAPTSGVLTKIV
AREDDTVEIGGELGVISEAGEAAPAAPAPAPAPAAAPAPEPTPAPAPEATATAAPEPAAE
PPAAAAPAGSGTSVKMPELGESVTEGTVTRWLKKVGDEVGVDEPLVEVSTDKVDTEIPSP
VAGVLLSISANEDDTVAVGGELAVVGAADAAPAAPAAPAAPAPEPAAAPAAAAAPPAPPA
PAPAPAAPAPASTAPAANGAAGDNPYVTPLVRKLAAENNVDLSALSGSGVGGRIRKQDVL
AAAEAAKAPAAAPAPAAPAASAPAAVAPSLAHLRGTTQKANRIRQITAKKTRESLQETAQ
LTQTHEVDVTKIAALRARAKAAFAEREGVNLTFLPFFAKAAVEALKTHPNVNASYNEESK
EITYFDAEHLGIAVDTDQGLLSPVIHNAGDLSLAGLARAIADIAARARSGNLKPDELAGG
TFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIRDDAGNESIGIRSVCYLPLTY
DHRLIDGADAGRFLTTIKHRLEEGAFEADLGL
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgcccgccctcggtgagagcgtgaccgaagggacggtgacg
cggtggctcaagcaagaaggcgacacggtcgaagtcgacgagccattgctcgaggtgtcc
accgacaaggtggacaccgagatcccagctcccacttcgggtgtgttgaccaagatcgtc
gcccgtgaggacgacaccgtcgagatcggcggcgagctcggtgtgatcagcgaggccgga
gaggcggctcccgccgcccccgcccccgcccccgcccccgcagccgcaccggctccggaa
ccgacacccgcaccggcccccgaagccactgctacggctgctcccgaacccgctgccgag
ccgcccgccgccgctgccccggccggctcgggcacctcggtcaagatgcccgagctcggt
gagtccgtcaccgaaggcaccgtgacccgctggctcaagaaggtcggcgacgaggtcggc
gtggacgaaccgctcgtcgaggtgtccaccgacaaggtcgacaccgagattccgtcgccg
gtggccggtgtgctgctcagcatctcggccaacgaggacgacaccgtggccgtgggcggc
gagcttgccgtcgtcggagccgccgacgccgcgcccgcggcccccgcagctcctgcggcg
cccgctcccgagcctgccgcagctcctgccgcggcagcggcaccgcctgctcccccagcc
ccagcccccgcaccggcggccccggctcccgcatcgacggccccggcagcgaacggtgcc
gccggcgacaacccgtacgtgaccccgctcgtgcgcaagctcgccgccgaaaacaacgtg
gacctttccgcgctgtccggcagcggggtgggcggacgcatccgcaagcaggatgtgctg
gccgccgcggaggccgccaaggctccggccgcggctcccgctcccgcggctcccgccgcg
tccgcgcctgcggccgtagcaccgtccctggcgcacctgcgcggaaccacgcagaaggcc
aaccggattcgtcagatcactgccaagaagacgcgcgagtcactgcaggagaccgcccag
ctgacccagacccacgaggtcgacgtcaccaagatcgcggccctgcgcgcccgggccaag
gccgcgttcgccgagcgcgagggtgtgaacctgacgttcctgccgttcttcgccaaggcc
gcggtggaggcactcaagacgcacccgaacgtcaacgcgagctacaacgaggaatccaag
gagatcacctacttcgacgccgagcacctgggcatcgcggtcgacaccgaccaaggcctg
ctctccccggtgatccacaacgccggtgacctgtcgctggccggtctggcgcgcgcgatc
gccgatatcgcggcacgggcccgttccgggaacctcaagcccgacgagctggccggtggc
accttcaccatcaccaacatcggcagccagggcgccttgttcgacacgccgattctggtg
ccgccgcaggccgccatgctcggcaccggcgcgatcgtgaagcgtcccagggttattcgt
gatgacgccggtaacgagtcgatcggtatccggtcggtgtgctacttgccgctgacctac
gatcaccgcctgatcgacggagccgacgcggggcggttcctgacgaccatcaaacaccgt
ctggaagagggggctttcgaggcggacctgggtctgtag

DBGET integrated database retrieval system