KEGG   Mycobacterium abscessus ATCC 19977: MAB_1960cHelp
Entry
MAB_1960c         CDS       T00657                                 

Definition
Probable asparagine synthetase AsnB
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAB_1960c
Enzymes [BR:mab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MAB_1960c
Peptidases [BR:mab01002]
 Cysteine Peptidases
  Family C44
   MAB_1960c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1957618..1959558)
Genome map
AA seq 646 aa AA seqDB search
MCGLVAWLGPPGSSLESHSPAVDAAMVHMRHRGPDEPGVWHEGNVLFGFNRLSIIDIAHS
HQPLRWGPPDAPGRYVLVFNGEIYNYLELRATLAAEHGAVFSTEGDGEAILAAYHFWGPD
ALHRLRGMFAFAIWDTVERELFCARDPFGIKPLFMATGPGGTALGSEKKCLLDLVEQLGI
GTELDLRALQHYTTLQYVPEPESLHTEIRRLESGSYARIAPGQEPRITRYFPARFEVAPF
TRATRQSRYDEITEVLSDSVAKHMRADVTVGSFLSGGIDSTAIAALAIRHNPKLITFTTG
FERQGYSEVDVAVESAQAIGARHIVKVVSQEEFVSALPEIVWYLDDPVADPSLVPLFFVA
REARKHVKVVLSGEGADELFGGYTIYREPLSLKPFEYLPDALRRGAARLSAAIPDGMRGK
SLLHRGSMTLEQRYYGNARSFDDEQLRAVLPHYRPEWGHQDVTASLYERCAGWDPVARMQ
YLDLFTWLRGDILVKADKMTMANSLELRVPFLDPEVFKVASRLPYREKINGQPTKRTTKY
ALRKALEPIVPAHVLHRTKLGFPVPIRHWFVDGLLHDWAREMLSTTQAGHLIDVPAVGRM
LTEHAAGASDHSRRLWTVLIFMLWHAIFVEQSVRPQIQEPHYPVQL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggactggtggcgtggctgggcccgcccgggtcttccctcgaatcccatagcccg
gcggtggatgccgcgatggtgcacatgcgccaccgcggccccgatgaaccgggcgtttgg
cacgagggaaacgtgctcttcggcttcaaccggctgtcgatcatcgacatcgcgcattca
catcagccgttgcgctggggtcccccggacgcgccgggccggtatgtgttggtcttcaac
ggcgagatctacaactacctggaactcagggcgacactggccgccgaacatggcgccgta
ttctccaccgagggcgacggcgaggcgatcctggcggcgtaccacttctgggggccggac
gcgctacaccggctgcgcggcatgttcgcattcgcgatctgggacaccgtggaacgcgag
ttgttctgcgcccgcgatcctttcggtatcaagccgctcttcatggcgaccggcccgggc
ggcaccgcactcggcagcgagaagaaatgcctgctggatctcgtcgaacagctgggcatc
gggaccgagttggacctgcgcgcgctgcagcattacacgacgctgcaatacgttccggag
cccgagagcctgcacaccgagatccgccgcctggaatccggttcgtacgcccgcatcgcc
cccggacaggagccgcgcatcacgcgctacttcccggcccgattcgaggtggccccgttc
acgcgtgccacgcgtcagtcccggtacgacgagatcaccgaggtgctctccgattcggtg
gccaagcatatgcgcgcggacgtgacggtgggctcgttcctgtccggcggcatcgactcg
acggccatcgccgcactggcgatccggcataaccccaagctcatcactttcacgacaggc
tttgagcggcaaggctattccgaggtcgatgtggcggtggagtcggcgcaggcaatcggc
gcccgccacatcgtcaaggtggtcagccaggaggagttcgtctccgcacttccggaaatc
gtgtggtacctggacgatccggtggcagatccgtccttggtgccgttgttcttcgtggca
cgcgaggcccgcaaacacgtcaaggtggtgctctccggcgagggcgccgacgagctgttc
ggcggatacacgatctaccgggagcccttgtcgctcaaacctttcgaatacttgccggac
gcactacggcgcggcgcggcgcgattgtcggccgccatcccggacggaatgcgcggtaag
agcctgctacaccgcggatcgatgaccctggagcagcgctactacggaaacgcccgcagc
ttcgacgatgagcagttgcgtgcggtgctcccccactaccgcccggaatggggccaccag
gacgtgacggcgtccctgtacgagcggtgtgcgggatgggatcccgtggcccgcatgcaa
tatctggatctgttcacctggctgcgcggcgacatcttggtcaaggccgacaagatgacc
atggccaactcgctggaactgcgggtaccgttcctcgaccccgaggtgttcaaggtggcc
tcgcggctgccctaccgggagaagatcaacgggcaaccgaccaagaggacgaccaagtac
gccttgcgcaaggcactggaacccattgtgccggcgcatgttctgcaccggaccaagctc
ggcttcccggtgcccatccggcattggtttgtcgacgggctactgcacgactgggcccgc
gagatgctctccaccacacaggcagggcacctgatcgacgtgcccgccgtcggccgcatg
ctcaccgaacacgccgccggcgccagcgatcacagccgcaggctgtggacagtgctgatc
ttcatgctgtggcacgcgatcttcgtcgagcagtcagtgcggccccagatccaggagccg
cactacccggtgcagctctaa

DBGET integrated database retrieval system