KEGG   Mycobacterium abscessus ATCC 19977: MAB_2001Help
Entry
MAB_2001          CDS       T00657                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase MurE
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mab00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mab00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1998726..2000273
Genome map
AA seq 515 aa AA seqDB search
MAASGTHRFLPRTHQHLVSDLASLVSAELHGPSATTVGGVTLRAQDARTGDLFAALPGTS
THGAQFASEAVSAGAAAVLTDAAGAELVAGQGLDIAVLVHPVPRSVLGELAATVYGEPSR
HLQVVGVTGTSGKTTTTYLVEAGLRAAGKRVGLIGTVGVRIDGEDVPSALTTPEAPALQE
LLAEMVQRGVDTVVMEVSSHALALNRVDGTRFAVGAFTNLSRDHLDFHPDMQDYFATKAR
LFRRDSPQRAHRSVVCIDDDAGRAMAELAREAGPDVTTVSSLDGGVADWRCSNVAVGHDG
GQRFVANGPDRDTELTIALPGHYNVANCLVAIAILDVLGVSAATAAPGIATAGVPGRMEA
VAAGQPFLAVVDYAHKPGALRAVLESLRSHRDGRLAVVFGAGGNRDRGKRADMGKVAAEL
ADLVVVTDDNPRNEEPAAIRTEIISGTTGSEAQIIEIGDRRAAIDFATLWARPGDTVLVA
GKGHESGQKTGDVTVPFDDRVELRAALEALGSLDD
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcatccggaacccatcggttccttccccggacgcaccagcacctggtctccgac
ctcgcgtcattggtttcggccgagctacacgggccaagcgccaccacggtggggggagtc
acgctcagggcgcaggacgcccgtacgggtgacctctttgccgcgctgccgggcaccagc
acccatggcgcgcagttcgcctctgaggcggtctccgcgggcgcggcggccgtgctgacg
gacgccgccggcgccgaactggtggcaggacagggtcttgatatcgcggtactggttcat
cccgtcccgcgctcggtgctcggtgagctggccgcgaccgtgtacggggagccctcccgt
catctacaggtagtgggagtcaccggtacctccggcaagaccacgaccacctacctggtc
gaggccgggctgcgggcggcgggtaagagggtgggtctcatcgggaccgtcggggtgcgg
atcgacggcgaggatgtgccgagtgccctgaccacgcccgaggcgccggcgttgcaggaa
ctgctcgccgagatggtccagcgcggggtggacacggtggtcatggaggtgtccagccat
gcgttggccctcaatcgtgtggacggcacccgttttgcggtaggcgcattcacgaacctg
tcacgcgatcacctggatttccatcccgacatgcaggattacttcgccaccaaggctcgc
ttgttccggcgcgattcgccgcagcgcgcgcaccgcagtgtcgtctgcatcgacgatgat
gccggccgcgccatggccgagctggcccgtgaggcgggacctgatgtcaccaccgtgagc
tcgctcgacggcggcgtcgcggactggagatgttcgaatgtggcggtcggtcatgatggt
ggccagcggttcgtcgcgaatggtccagaccgcgataccgagctcacaatcgcgttgcct
gggcattacaacgtggccaattgtcttgtggccattgcgatcttggatgttctcggagtt
tcggccgcgaccgccgcgcctggaatcgcgaccgcgggtgtgccggggcgtatggaagcc
gtggcggcggggcagccattcctggctgtcgtggactatgcccacaagcccggcgcgctg
cgggcagtcctggaaagtctgcgcagtcaccgcgatggccgcctggccgtggtgttcggt
gccggaggcaaccgtgatcgcggcaaacgggccgacatgggcaaggtcgccgcggagctg
gccgatctggtggtggtcaccgatgacaatccgcgcaacgaggagccggcggcgatccgt
accgagatcatttccgggactaccggttcggaggctcagatcatcgaaatcggcgaccgt
agagctgctatcgacttcgccacgttgtgggcgcggccgggcgataccgtccttgtcgcc
ggcaaggggcatgagagcggtcagaagaccggcgatgtcacggtgcctttcgatgatcgt
gtggagttgcgcgcagccctcgaagcgcttgggagcctggatgattga

DBGET integrated database retrieval system