KEGG   Mycobacterium abscessus ATCC 19977: MAB_2001Help
Entry
MAB_2001          CDS       T00657                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase MurE
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MAB_2001
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MAB_2001
Enzymes [BR:mab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     MAB_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1998726..2000273
Genome map
AA seq 515 aa AA seqDB search
MAASGTHRFLPRTHQHLVSDLASLVSAELHGPSATTVGGVTLRAQDARTGDLFAALPGTS
THGAQFASEAVSAGAAAVLTDAAGAELVAGQGLDIAVLVHPVPRSVLGELAATVYGEPSR
HLQVVGVTGTSGKTTTTYLVEAGLRAAGKRVGLIGTVGVRIDGEDVPSALTTPEAPALQE
LLAEMVQRGVDTVVMEVSSHALALNRVDGTRFAVGAFTNLSRDHLDFHPDMQDYFATKAR
LFRRDSPQRAHRSVVCIDDDAGRAMAELAREAGPDVTTVSSLDGGVADWRCSNVAVGHDG
GQRFVANGPDRDTELTIALPGHYNVANCLVAIAILDVLGVSAATAAPGIATAGVPGRMEA
VAAGQPFLAVVDYAHKPGALRAVLESLRSHRDGRLAVVFGAGGNRDRGKRADMGKVAAEL
ADLVVVTDDNPRNEEPAAIRTEIISGTTGSEAQIIEIGDRRAAIDFATLWARPGDTVLVA
GKGHESGQKTGDVTVPFDDRVELRAALEALGSLDD
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcatccggaacccatcggttccttccccggacgcaccagcacctggtctccgac
ctcgcgtcattggtttcggccgagctacacgggccaagcgccaccacggtggggggagtc
acgctcagggcgcaggacgcccgtacgggtgacctctttgccgcgctgccgggcaccagc
acccatggcgcgcagttcgcctctgaggcggtctccgcgggcgcggcggccgtgctgacg
gacgccgccggcgccgaactggtggcaggacagggtcttgatatcgcggtactggttcat
cccgtcccgcgctcggtgctcggtgagctggccgcgaccgtgtacggggagccctcccgt
catctacaggtagtgggagtcaccggtacctccggcaagaccacgaccacctacctggtc
gaggccgggctgcgggcggcgggtaagagggtgggtctcatcgggaccgtcggggtgcgg
atcgacggcgaggatgtgccgagtgccctgaccacgcccgaggcgccggcgttgcaggaa
ctgctcgccgagatggtccagcgcggggtggacacggtggtcatggaggtgtccagccat
gcgttggccctcaatcgtgtggacggcacccgttttgcggtaggcgcattcacgaacctg
tcacgcgatcacctggatttccatcccgacatgcaggattacttcgccaccaaggctcgc
ttgttccggcgcgattcgccgcagcgcgcgcaccgcagtgtcgtctgcatcgacgatgat
gccggccgcgccatggccgagctggcccgtgaggcgggacctgatgtcaccaccgtgagc
tcgctcgacggcggcgtcgcggactggagatgttcgaatgtggcggtcggtcatgatggt
ggccagcggttcgtcgcgaatggtccagaccgcgataccgagctcacaatcgcgttgcct
gggcattacaacgtggccaattgtcttgtggccattgcgatcttggatgttctcggagtt
tcggccgcgaccgccgcgcctggaatcgcgaccgcgggtgtgccggggcgtatggaagcc
gtggcggcggggcagccattcctggctgtcgtggactatgcccacaagcccggcgcgctg
cgggcagtcctggaaagtctgcgcagtcaccgcgatggccgcctggccgtggtgttcggt
gccggaggcaaccgtgatcgcggcaaacgggccgacatgggcaaggtcgccgcggagctg
gccgatctggtggtggtcaccgatgacaatccgcgcaacgaggagccggcggcgatccgt
accgagatcatttccgggactaccggttcggaggctcagatcatcgaaatcggcgaccgt
agagctgctatcgacttcgccacgttgtgggcgcggccgggcgataccgtccttgtcgcc
ggcaaggggcatgagagcggtcagaagaccggcgatgtcacggtgcctttcgatgatcgt
gtggagttgcgcgcagccctcgaagcgcttgggagcctggatgattga

DBGET integrated database retrieval system