KEGG   Mycobacterium abscessus ATCC 19977: MAB_2115Help
Entry
MAB_2115          CDS       T00657                                 

Definition
Probable inositol monophosphatase CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MAB_2115
Enzymes [BR:mab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MAB_2115
Transfer RNA biogenesis [BR:mab03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MAB_2115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2113163..2113927
Genome map
AA seq 254 aa AA seqDB search
MTVSDAALAAELAHEAGQLLLQVRTELGFDDPKGLGAAGDKRSNTLLLERLAAERPADAV
LSEEAVDDKARLGAQRVWIIDPLDGTREFGMEGRNDWAVHVALWQADGDGGSITDAAVAL
PGLDTVFRTDETRVTAAARAEADPIRIVASASRAPKFLTDMAERLNIELIPMGSAGAKAM
AVVRGEADAYLHGGGQWEWDSAAPAGVVLAAGLHASRLDGSPLRYNEPHPYLPDLIMCRP
DLAPVLLDAVAGRA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtttccgatgccgcgctcgccgcggagctcgcccacgaggccggacaactgctg
ctgcaggtgcgtaccgagcttgggttcgacgaccccaagggcctcggtgcggcaggcgac
aagcgttccaacacgctgctgctggagcggctggcggcagagcgccccgccgatgcggtg
ctctctgaggaagccgtggacgacaaggcgcgtctgggtgcacaacgggtgtggatcatc
gatccgctcgatggcacgcgcgagttcggcatggaaggccgcaacgactgggcggtgcat
gtcgccttgtggcaagccgacggagacggcggttcgatcaccgacgccgcggtggcgctg
cccggactggacaccgtgtttcgtaccgacgagaccagggtgacggctgcggcgcgcgct
gaggcggatccgatccggatcgtggccagcgctagccgggcgcccaaattcctcaccgat
atggccgagcggctcaacatcgagctgattccgatgggttcggcgggggccaaggccatg
gcggtcgtgcgtggtgaggccgacgcgtacctgcatggcggtgggcaatgggaatgggat
tcggcggctcccgcgggagtggtgctggcggcggggctgcacgcctcccggctcgatgga
tctccgcttcggtacaacgagccgcatccgtacctgcccgacctgatcatgtgccggccg
gatttggcgccggtgctgctggacgcggtcgccgggcgcgcctaa

DBGET integrated database retrieval system