KEGG   Mycobacterium abscessus ATCC 19977: MAB_2409cHelp
Entry
MAB_2409c         CDS       T00657                                 

Definition
Malate synthase G GlcB
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAB_2409c
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAB_2409c
   00630 Glyoxylate and dicarboxylate metabolism
    MAB_2409c
Enzymes [BR:mab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MAB_2409c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2466805..2469012)
Genome map
AA seq 735 aa AA seqDB search
MSDRVDVGNLRVARVLYDFITNEALPGTGVDADAFWAGVDKVVTDLAPRNRELLERRDDL
QTQVDRWHRQRAIEPLDGAAYQDFLTEIGYLVPEPEDFTITTANVDDEITTTAGPQLVVP
ILNARFALNAANARWGSLYDALYGTDVIPEADGAEKASADTGGYNKVRGDKVIAYAREVL
DGAAPLASGSWKDAVGLKIDDGQLLVELGDEFSTGLQNPDQFVGYTGKLGKPQWSVLLIN
HGLHIEVLIDPDSPIGSTDKAGIKDVVLESAITTIMDFEDSVAAVDAEDKVLGYRNWLGL
NKGDLSEEVSKGGKTFTRVLNEDRVFTTPDGKGELTLPGRSLLFVRNVGHLMTNDAIVDA
AGNEMPEGIQDALFTSLIAIHGLRSGKKNGPLKNSRTGSIYIVKPKMHGPEEVAFTAELF
GRVEEVLGLPHATLKVGIMDEERRTTVNLKAAIKAASDRVVFINTGFLDRTGDEIHTSME
AGPMCRKAVMKSQPWILAYEDHNVDTGLGAGLAGKAQIGKGMWAMPDLMADMVAQKIAQP
RAGATTAWVPSPTAATLHALHYHQVDVKAVDQELAGKHRAKLESLLTIPLAESRHDWTAE
DIREEIDNNCQSILGYVVRWIDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHDV
ITEDEVVEGLKRMAPVVDRQNAGDKEYRPMAPDFDSNIAFQAAKELILEGKDQPNGYTEP
ILHRRRREYKAAAAK
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgcgtcgatgtgggcaacctacgcgtggcgcgggtgctgtatgacttcatc
accaacgaggcccttccgggcaccggtgtggatgccgacgctttctgggctggagtcgac
aaagtagtcaccgatttggctccgcggaaccgcgagctgctcgagcgccgggacgacctg
caaactcaggtcgatcgctggcaccggcagcgcgccatcgaaccgctcgatggcgcggcg
taccaggacttcctgaccgagatcggatacctggttcccgagcccgaagatttcaccatc
accaccgccaatgtggacgacgaaatcaccaccacggccggtccgcagctggtggtgccg
atcctgaacgcgcgcttcgcgctcaacgccgccaacgcgcgctggggctccctctacgac
gcgctatacggcaccgatgtcatcccggaagccgatggcgccgaaaaggcgtccgctgac
actggtgggtacaacaaggtccgcggtgacaaggtcatcgcctacgcccgcgaggtgctc
gacggtgctgcgccgctggcatccggctcgtggaaggacgccgtcggcctgaagatcgac
gacggccagctgctcgtcgagctgggcgacgagttctcgacgggcctgcagaaccccgat
caattcgtgggctacaccggcaagctcggtaagccgcagtggtcggtgctactgatcaac
cacggcctgcatatcgaggtgctgatcgaccccgactcccccatcggttccaccgacaag
gccggcatcaaggatgtggtgctggagtcggcgatcaccacgatcatggacttcgaggac
tctgtcgcggccgtggacgccgaggacaaggtgctcgggtaccgaaactggttgggcctc
aacaagggcgacctgtccgaagaggtgtccaagggcggcaagacgttcacccgcgtgctc
aacgaggaccgtgtcttcaccacccccgacggcaagggcgagctgacgctgcccggtcgc
agcctgctattcgtccgcaacgtcggtcatctgatgaccaatgacgccatcgtggacgcc
gcgggcaacgagatgcccgagggcatccaggacgcgctgttcaccagtctgatcgccatc
cacggcctgcgctcgggcaagaagaacggcccgctcaagaacagccgcaccggctcgatc
tacatcgtgaagcccaagatgcacgggcccgaggaagtggccttcaccgccgaactgttc
ggccgcgtggaagaggtgctcggattgccgcacgccaccctcaaggtcggcatcatggac
gaggagcgccgcaccaccgtaaatctgaaggcagccatcaaggccgcttcggatcgggtg
gtcttcatcaacaccggattcctggaccgcactggcgacgagatccacacctccatggaa
gccggcccgatgtgtcgtaaggccgtcatgaagtcgcaaccgtggatcctggcgtacgag
gaccacaacgtggatacggggctgggcgccggattggccggcaaggcacagatcggcaag
ggcatgtgggccatgccggacctgatggcggacatggtggcgcagaagatcgcgcagcca
cgcgctggtgcgaccacggcgtgggtgccgtcccccaccgcggcgactctgcacgcgctg
cactaccaccaggtcgacgtcaaggcggtggaccaggagctcgccggtaagcaccgcgcc
aagctggagtctttgctcaccatcccgctggccgagtcgcgccatgactggaccgccgaa
gacatccgcgaggaaatcgacaacaactgccagtcgatcctgggttacgtggtccgctgg
atcgaccagggcgtcggctgctccaaggtgccggatatccatgacgtggcactcatggaa
gaccgcgccaccctacgcatctccagccagctactggccaactggttgcgccacgatgtg
atcaccgaggacgaggtggtcgaggggctcaagcggatggctccggttgtcgaccggcag
aacgcgggcgacaaggagtaccgcccgatggctccggacttcgacagcaacattgccttc
caggccgccaaggaactcatcctggagggcaaggaccagccgaacggttacaccgagccg
atcttgcaccggcggcgccgtgagtacaaggccgccgctgccaagtag

DBGET integrated database retrieval system