KEGG   Mycobacterium abscessus ATCC 19977: MAB_2643cHelp
Entry
MAB_2643c         CDS       T00657                                 

Definition
Tryptophan synthase, alpha subunit (TrpA)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAB_2643c
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAB_2643c
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MAB_2643c
Enzymes [BR:mab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MAB_2643c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2683915..2684703)
Genome map
AA seq 262 aa AA seqDB search
MTQPGRLTEVFDKCRAEERAALIGYLPNGYPDLDTSIELMTTLVRGGCDIIEVGIAYSDP
MMDGPMIAAAAETALANGVRVADVFTTVRAITDAGGHAVVMSYWNPVLRYGVDAFARELA
AAGGLGIITPDLIPDEADDWIAASDAHDLDRIFLVAPSSTPERLERTIGACRGFVYAAST
MGVTGARDAVSNAAPALVSRVREVSDIAVGVGLGVRSGAQAAEIAAYADGVIVGSALVAA
APQGPAAVRSLAEELATGVRRA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcccggccgtctgaccgaggtcttcgacaagtgccgcgccgaagaacgcgcc
gcgctgatcgggtacctgcccaacggttacccggacctggacacctcgatcgaactgatg
accaccctggtgcggggcgggtgcgacatcatcgaagtggggatcgcgtactcggatccg
atgatggacggcccgatgatcgccgccgcagcggaaacggcgctcgccaacggggttcgg
gtggccgacgtcttcaccaccgtccgcgccatcaccgatgccggcggtcacgcggtcgtc
atgtcctactggaacccggtgctgcgttacggcgttgacgcgttcgcacgtgagctcgcc
gcggcgggtggcctcggaatcatcacaccggatctgatcccggacgaggccgatgactgg
atcgccgcctcggacgctcatgacctggaccggatctttcttgtcgccccgtcgtccacg
cccgaaaggctggagaggaccatcggcgcctgccggggatttgtctacgcggcgtcgacc
atgggtgtcacgggtgcgcgtgacgcggtatccaatgccgcacccgccctggtgagcagg
gtccgtgaggtctccgatatcgcggtgggggtcggactcggcgtgcggtcgggcgcgcag
gcggccgagatcgcggcctacgccgacggcgtcatcgtcgggtcggcgttggtggcggcg
gccccgcaggggccggccgccgtgcgcagcctggccgaggagctggccaccggagtccga
agggcatga

DBGET integrated database retrieval system