KEGG   Mycobacterium abscessus ATCC 19977: MAB_2643cHelp
Entry
MAB_2643c         CDS       T00657                                 

Definition
(RefSeq) Tryptophan synthase, alpha subunit (TrpA)
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
mab00260  Glycine, serine and threonine metabolism
mab00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01130  Biosynthesis of antibiotics
mab01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAB_2643c
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MAB_2643c
Enzymes [BR:mab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MAB_2643c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth
Motif
Other DBs
NCBI-GeneID: 5965152
NCBI-ProteinID: YP_001703377
UniProt: A0A2C9Y3E2
Position
complement(2683915..2684703)
Genome map
AA seq 262 aa AA seqDB search
MTQPGRLTEVFDKCRAEERAALIGYLPNGYPDLDTSIELMTTLVRGGCDIIEVGIAYSDP
MMDGPMIAAAAETALANGVRVADVFTTVRAITDAGGHAVVMSYWNPVLRYGVDAFARELA
AAGGLGIITPDLIPDEADDWIAASDAHDLDRIFLVAPSSTPERLERTIGACRGFVYAAST
MGVTGARDAVSNAAPALVSRVREVSDIAVGVGLGVRSGAQAAEIAAYADGVIVGSALVAA
APQGPAAVRSLAEELATGVRRA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcccggccgtctgaccgaggtcttcgacaagtgccgcgccgaagaacgcgcc
gcgctgatcgggtacctgcccaacggttacccggacctggacacctcgatcgaactgatg
accaccctggtgcggggcgggtgcgacatcatcgaagtggggatcgcgtactcggatccg
atgatggacggcccgatgatcgccgccgcagcggaaacggcgctcgccaacggggttcgg
gtggccgacgtcttcaccaccgtccgcgccatcaccgatgccggcggtcacgcggtcgtc
atgtcctactggaacccggtgctgcgttacggcgttgacgcgttcgcacgtgagctcgcc
gcggcgggtggcctcggaatcatcacaccggatctgatcccggacgaggccgatgactgg
atcgccgcctcggacgctcatgacctggaccggatctttcttgtcgccccgtcgtccacg
cccgaaaggctggagaggaccatcggcgcctgccggggatttgtctacgcggcgtcgacc
atgggtgtcacgggtgcgcgtgacgcggtatccaatgccgcacccgccctggtgagcagg
gtccgtgaggtctccgatatcgcggtgggggtcggactcggcgtgcggtcgggcgcgcag
gcggccgagatcgcggcctacgccgacggcgtcatcgtcgggtcggcgttggtggcggcg
gccccgcaggggccggccgccgtgcgcagcctggccgaggagctggccaccggagtccga
agggcatga

DBGET integrated database retrieval system