KEGG   Mycobacterium abscessus ATCC 19977: MAB_2643cHelp
Entry
MAB_2643c         CDS       T00657                                 

Definition
Tryptophan synthase, alpha subunit (TrpA)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mab01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mab00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mab00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2683915..2684703)
Genome map
AA seq 262 aa AA seqDB search
MTQPGRLTEVFDKCRAEERAALIGYLPNGYPDLDTSIELMTTLVRGGCDIIEVGIAYSDP
MMDGPMIAAAAETALANGVRVADVFTTVRAITDAGGHAVVMSYWNPVLRYGVDAFARELA
AAGGLGIITPDLIPDEADDWIAASDAHDLDRIFLVAPSSTPERLERTIGACRGFVYAAST
MGVTGARDAVSNAAPALVSRVREVSDIAVGVGLGVRSGAQAAEIAAYADGVIVGSALVAA
APQGPAAVRSLAEELATGVRRA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcccggccgtctgaccgaggtcttcgacaagtgccgcgccgaagaacgcgcc
gcgctgatcgggtacctgcccaacggttacccggacctggacacctcgatcgaactgatg
accaccctggtgcggggcgggtgcgacatcatcgaagtggggatcgcgtactcggatccg
atgatggacggcccgatgatcgccgccgcagcggaaacggcgctcgccaacggggttcgg
gtggccgacgtcttcaccaccgtccgcgccatcaccgatgccggcggtcacgcggtcgtc
atgtcctactggaacccggtgctgcgttacggcgttgacgcgttcgcacgtgagctcgcc
gcggcgggtggcctcggaatcatcacaccggatctgatcccggacgaggccgatgactgg
atcgccgcctcggacgctcatgacctggaccggatctttcttgtcgccccgtcgtccacg
cccgaaaggctggagaggaccatcggcgcctgccggggatttgtctacgcggcgtcgacc
atgggtgtcacgggtgcgcgtgacgcggtatccaatgccgcacccgccctggtgagcagg
gtccgtgaggtctccgatatcgcggtgggggtcggactcggcgtgcggtcgggcgcgcag
gcggccgagatcgcggcctacgccgacggcgtcatcgtcgggtcggcgttggtggcggcg
gccccgcaggggccggccgccgtgcgcagcctggccgaggagctggccaccggagtccga
agggcatga

DBGET integrated database retrieval system