KEGG   Mycobacterium abscessus ATCC 19977: MAB_2644cHelp
Entry
MAB_2644c         CDS       T00657                                 

Definition
Tryptophan synthase, beta subunit (TrpB)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAB_2644c
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAB_2644c
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MAB_2644c
Enzymes [BR:mab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MAB_2644c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2684700..2685959)
Genome map
AA seq 419 aa AA seqDB search
MKNTGLPQMSTAIAEPTAHDPDARGHFGPYGGRYVAEALMAVIEEVTAAYEKIRSDRSFL
DELDRLQTHYVGRPSPLYEAERLSAHAGGARIFLKREDLNHTGSHKINNVLGQVLLAKKM
GKTRVIAETGAGQHGVATATACALLGLECVIYMGAVDTARQALNVARMRLLGSTVVSVES
GSKTLKDAINDAMRDWVTNAHNTYYCFGTAAGPHPFPVMVRDFQRIIGMEARAQVLDQVG
RLPDAAVACVGGGSNAIGLFHAFIDDPAVRLVGYEAAGDGVETGRHAATFTGGTPGAFQG
SYSYLLQDDDGQTIESHSISAGLDYPGVGPEHAWLRESGRADYRPITDGEAMDAFLLLSR
AEGIIPAIESAHAVAGALKLGGELSEGAVIVVSLSGRGDKDVETAAKWFDLLEKDGSQS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaccggcctgccgcagatgagcactgcgatcgctgagcccaccgcgcacgat
cctgacgcccggggccatttcggtccgtacggtggccgctacgtggccgaggcactgatg
gccgtcatcgaggaagtaacggccgcctacgaaaagatcaggtccgaccggtcattcctc
gacgaactcgatcgcttgcagacccactacgtgggacgcccatcgccgctgtacgaagcg
gaacgacttagtgctcacgccggcggcgcacgtatctttctcaaacgagaagacctgaac
cacactggttctcacaagatcaacaacgttctcggtcaagttctactggccaagaagatg
ggcaagacccgcgtgatcgccgagaccggtgccgggcagcacggtgttgccaccgccacc
gcatgcgcgctgctgggcctggaatgcgtgatttacatgggcgcggtcgacaccgcacgg
caagccctcaatgtcgcgcggatgcggctgttgggatcgaccgtggtgtcggtggaatcg
gggtcgaaaaccctcaaggacgcgatcaatgacgcgatgcgtgactgggtaaccaacgcg
cacaacacctattactgcttcggtacggccgccgggccgcacccctttccggtgatggtc
cgcgattttcagcgcatcatcggtatggaggcgcgggcgcaagttctcgatcaagtgggc
agattgccggatgcggcagtggcctgcgtcggcggcggctccaacgccatcggcctgttc
catgcgtttatcgatgatccggcagtgcgcctggtgggctacgaggctgcgggtgacggt
gtcgaaaccggaaggcacgccgccacattcaccggtggtaccccgggcgctttccagggc
tcctactcttatctgctccaggacgacgacggtcagaccatcgaatctcattcgatctca
gccggtctggactacccgggagtcggaccggagcacgcctggctgcgtgagagcgggcgc
gcggactaccgtccgatcaccgacggcgaggccatggatgccttcctgttgctttcgcgt
gcagagggcatcatccccgccatcgaatcggcgcacgccgtggccggcgcactcaaactc
ggcggcgagttgagcgagggcgcggtcatcgtggtgagcctgtcgggtcgcggcgacaag
gatgtcgagaccgccgccaagtggttcgacctactggagaaggacggcagccagtcatga

DBGET integrated database retrieval system