KEGG   Mycobacterium abscessus ATCC 19977: MAB_2645cHelp
Entry
MAB_2645c         CDS       T00657                                 

Definition
Indole-3-glycerol phosphate synthase TrpC
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAB_2645c
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MAB_2645c
Enzymes [BR:mab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MAB_2645c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2685965..2686783)
Genome map
AA seq 272 aa AA seqDB search
MSSGTVLDSILDGVRADVAAREAVVDLATVKAAAKAAPKPLDVMAALREPGIAVIAEVKR
ASPSRGALAEISDPAELAKAYEDGGARIISVLTEGRRFNGSLDDLDSVRAAVSVPVLRKD
FVISPYQIHEARAHGADLILLIVAALEQTALVSLLDRTESLGMTALVEVHTEEEADRALS
AGASVIGVNARDLKTLEIDRDCFSRIAPGLPSGVIRIAESGVRGTADLLAYAGAGADAVL
VGEGLVTSGDPRGAVADLVTAGTHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgggaaccgtactcgattcgatcctcgatggcgtgcgcgctgatgtcgcggct
cgcgaagccgttgtcgatcttgccaccgtgaaggcagccgccaaggccgcgcccaagcca
ctcgatgtgatggcggctctgcgcgagcccggtatcgccgtcatcgccgaggtcaagcgt
gccagcccgtcgcgcggcgcgctggcggagatcagcgatcccgccgagctcgccaaggcc
tatgaagacgggggagcccgcatcatcagcgtgctcaccgaggggcggcggttcaacgga
agtctcgacgacctggactccgtgcgtgccgcggtgtcggttcccgtgctgcgcaaggac
tttgtgatcagcccgtatcagatccacgaggcgcgtgcgcatggcgccgatctgatcctg
ctgatcgtggcggcgctcgaacagacggcgttggtctcgctgcttgatcgcaccgagtcg
ctcggcatgaccgccttggtcgaagtgcacaccgaagaagaggccgatagggctctgtcc
gccggagcctcggtcatcggcgtgaacgcgcgcgatctgaaaactcttgaaatcgatcgg
gattgcttctctcgcatcgccccgggactgcccagcggtgtcatccgcatcgccgagtcg
ggggtccgcgggaccgccgatctactcgcctacgccggcgccggcgcagatgccgtactg
gtgggtgaggggctggtgaccagcggagacccccgaggtgcggtcgccgatctggtgacc
gcgggcacgcatccgtcctgccccaaaccggctcgctag

DBGET integrated database retrieval system