KEGG   Mycobacterium abscessus ATCC 19977: MAB_2670cHelp
Entry
MAB_2670c         CDS       T00657                                 

Definition
Histidinol dehydrogenase (HisD)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAB_2670c
  Amino acid metabolism
   00340 Histidine metabolism
    MAB_2670c
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MAB_2670c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2711382..2712722)
Genome map
AA seq 446 aa AA seqDB search
MNDAAPVLLRRIDMRGASLSPSHLRAALPRGGTDVDAVLPRVRPVVEAVRDRGAEAALDF
CAEFDGVRPGTVRVPAAELDRALADLDPAVRDALEVAILRARAVHADQRRQDTVTTVADG
ATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQTAGVGSLVIASPPQAQFGGLPHPT
ILAAAQLLGVQEVWAVGGAQGVALLAHGGTDTDGAELAPVDMITGPGNIYVTAAKRLCRS
LVGIDAEAGPTEIAILADETADPVHVAADLISQAEHDVLAASVLVTDSAALADAVVKETS
AQLATTVHAERVTAALTGTQSGIVLVDDIDAGIKVVNAYAAEHLEIHTVEPVPVAARVRN
AGAIFLGPWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHIVDYTEAALKEVA
GHVITLANAENLPAHGEAVRRRFERS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgacgccgcgcccgtcctgcttcgccgtatcgatatgcgtggtgcgagcctgtcg
ccgtcgcacctgcgcgctgccctgcccaggggtggcacggacgtcgacgcggtattaccg
cgggtgcggcccgtcgtagaggcagttcgtgaccgcggcgcggaggccgcactggatttc
tgtgccgaattcgatggtgtccgtcccggcaccgtccgggttcccgcggcagagctggac
cgcgccctcgccgatctagaccccgccgtgcgcgacgcgctcgaggtggcgattctgcgt
gcccgggccgtacacgccgatcagcgccgccaggacaccgtaaccacggttgccgacggc
gcgacggtgaccgagcggtgggtacctgtcgagcgggtgggcctatacgtgcccggtggc
aacgccgtgtacccatcgagcgtcgtgatgaacgttgtgcccgcgcaaacagcgggagtg
ggatcgctcgtcatagcgtcgccgccccaagcgcagttcggcggtctgccgcatccgacc
attttggcggcggcgcagttgctcggtgtccaagaagtctgggcggtcggtggcgcacag
ggcgtggcgctgctggcgcacggcggcaccgataccgatggggctgagctcgcaccggtc
gacatgatcaccgggcccggaaacatctatgtcaccgctgccaagcggttgtgccgatcg
ctggtgggcatcgacgcggaggccggccctacggagatcgcgattctcgctgacgagacc
gccgatccggtgcatgtggccgccgacctgatcagccaggccgaacacgatgtgttggcg
gccagcgtcttggtcaccgacagtgcggcacttgccgacgcggtggtcaaggagacctct
gcgcaattggcgaccacggtgcacgccgaacgcgtcaccgctgcgctgaccggcacgcaa
tccgggatcgtgcttgtcgacgacatcgacgcgggcatcaaggtggtaaacgcctacgcg
gccgagcacctggagattcacacggtggaaccggtgccggtggccgcgcgggtgcgcaat
gccggtgcgattttcctggggccgtggtcgccggtgagcctcggcgactactgcgccggc
tccaaccacgtactacccaccgccggatgcgcgcggcattccagcgggttgtccgtgcag
accttcctgcgcggtatccacatcgtggactacaccgaagcggcactcaaagaggtcgcc
gggcatgtgatcacactggctaacgccgagaatctgcccgcgcacggtgaggccgtccga
cgcaggttcgagcgatcatga

DBGET integrated database retrieval system