KEGG   Mycobacteroides abscessus ATCC 19977: MAB_2737cHelp
Entry
MAB_2737c         CDS       T00657                                 

Definition
(RefSeq) Probable enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00071  Fatty acid degradation
mab00280  Valine, leucine and isoleucine degradation
mab00281  Geraniol degradation
mab00310  Lysine degradation
mab00360  Phenylalanine metabolism
mab00362  Benzoate degradation
mab00380  Tryptophan metabolism
mab00410  beta-Alanine metabolism
mab00627  Aminobenzoate degradation
mab00640  Propanoate metabolism
mab00650  Butanoate metabolism
mab00903  Limonene and pinene degradation
mab00930  Caprolactam degradation
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01120  Microbial metabolism in diverse environments
mab01130  Biosynthesis of antibiotics
mab01212  Fatty acid metabolism
Module
mab_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MAB_2737c
   00650 Butanoate metabolism
    MAB_2737c
  Lipid metabolism
   00071 Fatty acid degradation
    MAB_2737c
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAB_2737c
   00310 Lysine degradation
    MAB_2737c
   00360 Phenylalanine metabolism
    MAB_2737c
   00380 Tryptophan metabolism
    MAB_2737c
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAB_2737c
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAB_2737c
   00281 Geraniol degradation
    MAB_2737c
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAB_2737c
   00627 Aminobenzoate degradation
    MAB_2737c
   00930 Caprolactam degradation
    MAB_2737c
Enzymes [BR:mab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MAB_2737c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 5965245
NCBI-ProteinID: YP_001703470
UniProt: A0A0U0YV45
Structure
PDB: 

Jmol
Position
complement(2786257..2787066)
Genome map
AA seq 269 aa AA seqDB search
MSFVLVDRPRPEIALVTLNRPERMNAMAFDVMLPFKQMLVDISHDNDVRAVVITGAGKGF
CSGADQKSAGPIPHIGGLTQPTIALRSMELLDEVILTLRRMHQPVIAAINGAAIGGGLCL
ALACDVRVASQDAYFRAAGINNGLTASELGLSYLLPRAIGTSRASDIMLTGRDVDADEAE
RIGLVSRKVASESLLEECYAIGERIAGFSRPGIELTKRTIWSGLDAASLESHMHQEGLGQ
LYVRLLTDNFEEATAARKEKRPAEFRDKR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcgtcctggtggaccgtccgcgtccggaaattgccctggtcaccctgaaccgg
cccgagcggatgaatgccatggcgttcgacgtgatgctgcctttcaagcagatgctcgtc
gatatcagccacgacaatgacgtgcgcgccgtcgtgatcacgggcgccggtaagggcttt
tgttcgggcgccgaccagaagtcggccggccccattccgcatatcggcggactgacccag
cccaccatcgcgttgcgttccatggaactgctcgacgaggtgatcctcacgctgcgccgc
atgcatcagccggtgatcgcggccatcaacggtgcggccatcggcggcggactatgcctg
gcgctggcgtgcgacgtccgggtggcctcgcaggacgcgtacttccgggcggccggaatc
aacaacgggttgaccgccagcgaactgggtctgagctatctgctgccccgcgccatcggc
acctcgcgcgcctctgacatcatgttgaccggccgcgacgtcgacgccgacgaggccgaa
cgcatcggattggtatcccggaaggtggcgtccgagtcgctgctggaagagtgttacgcg
atcggggaacgcatcgccgggttctcccgtccgggaatcgagttgaccaagcgcacgatt
tggagtgggctggacgccgctagcctggaaagtcatatgcaccaagagggcctgggccag
ctatatgtccggctactcaccgacaacttcgaagaagccaccgccgcgcgcaaggagaag
cggccggcggaattcagagacaagcgctga

DBGET integrated database retrieval system