KEGG   Mycobacterium abscessus ATCC 19977: MAB_2777cHelp
Entry
MAB_2777c         CDS       T00657                                 

Definition
Probable triosephosphate isomerase (TpiA)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAB_2777c
   01230 Biosynthesis of amino acids
    MAB_2777c
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAB_2777c
   00051 Fructose and mannose metabolism
    MAB_2777c
   00562 Inositol phosphate metabolism
    MAB_2777c
Enzymes [BR:mab01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MAB_2777c
Exosome [BR:mab04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MAB_2777c
  Exosomal proteins of bladder cancer cells
   MAB_2777c
  Exosomal proteins of melanoma cells
   MAB_2777c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2824090..2824875)
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVTVIPPFTDIRSVQTLVDGD
KLRLTYGAQDLSVYDSGAYTGEVSGAFLAKLGVTYVVVGHSERRQYHGEDDALVAAKAAA
ALKHGLTPIVCIGEALDIREAGDHVQYNVNSLRGSLAGLSAEQVGKVVIAYEPVWAIGTG
RVASAADAQEVCAAIRAELAQIANADVAGSVRVLYGGSANAKNVGEIVAQEDVDGALVGG
ASLDGEQFAQMSAIAAGGPLL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtaagccgttgatcgccggcaactggaagatgaacctcaatcatttcgaggcc
atcgctttggtgcagaagatcgcgttctcgttgccggacaagtacttcgacaaggtggac
gtgacggtcattccgccgttcaccgatatccgcagcgtgcagaccctggtcgacggtgac
aagttacgccttacctacggcgcacaggacctgtccgtatatgactcgggcgcgtacacc
ggtgaggtcagcggcgccttcctggccaagctgggtgtcacctatgtcgttgtcgggcac
tccgagcgccgccagtatcacggcgaggacgacgcgctggtggcggccaaggcggccgcg
gccctcaaacacggcctcacaccgatcgtgtgtatcggtgaggcacttgacatccgggaa
gccggagatcacgtccagtacaacgtgaactccttgcgtgggtcactggccggcctcagc
gccgaacaggtgggcaaggtggttatcgcctacgagccggtgtgggccatcggcaccggg
cgggtggccagcgccgccgacgcgcaggaagtgtgcgccgcgatccgcgccgagttggcg
caaatcgcgaacgccgacgtggcggggtctgtccgggtcttgtatggcggctcggccaac
gccaagaatgtcggcgagatcgttgcgcaggaggatgtcgacggagcgttggtcggtggc
gcctcgctggacggcgagcagttcgcccagatgtcggcgatcgccgcgggcggtccgctg
ctttag

DBGET integrated database retrieval system