KEGG   Mycobacteroides abscessus ATCC 19977: MAB_2777cHelp
Entry
MAB_2777c         CDS       T00657                                 

Definition
(RefSeq) Probable triosephosphate isomerase (TpiA)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00010  Glycolysis / Gluconeogenesis
mab00051  Fructose and mannose metabolism
mab00562  Inositol phosphate metabolism
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01120  Microbial metabolism in diverse environments
mab01130  Biosynthesis of antibiotics
mab01200  Carbon metabolism
mab01230  Biosynthesis of amino acids
Module
mab_M00002  Glycolysis, core module involving three-carbon compounds
mab_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAB_2777c
   00051 Fructose and mannose metabolism
    MAB_2777c
   00562 Inositol phosphate metabolism
    MAB_2777c
Enzymes [BR:mab01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MAB_2777c
Exosome [BR:mab04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MAB_2777c
  Exosomal proteins of bladder cancer cells
   MAB_2777c
  Exosomal proteins of melanoma cells
   MAB_2777c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5965285
NCBI-ProteinID: YP_001703510
UniProt: A0A0U0YM95
Position
complement(2824090..2824875)
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVTVIPPFTDIRSVQTLVDGD
KLRLTYGAQDLSVYDSGAYTGEVSGAFLAKLGVTYVVVGHSERRQYHGEDDALVAAKAAA
ALKHGLTPIVCIGEALDIREAGDHVQYNVNSLRGSLAGLSAEQVGKVVIAYEPVWAIGTG
RVASAADAQEVCAAIRAELAQIANADVAGSVRVLYGGSANAKNVGEIVAQEDVDGALVGG
ASLDGEQFAQMSAIAAGGPLL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtaagccgttgatcgccggcaactggaagatgaacctcaatcatttcgaggcc
atcgctttggtgcagaagatcgcgttctcgttgccggacaagtacttcgacaaggtggac
gtgacggtcattccgccgttcaccgatatccgcagcgtgcagaccctggtcgacggtgac
aagttacgccttacctacggcgcacaggacctgtccgtatatgactcgggcgcgtacacc
ggtgaggtcagcggcgccttcctggccaagctgggtgtcacctatgtcgttgtcgggcac
tccgagcgccgccagtatcacggcgaggacgacgcgctggtggcggccaaggcggccgcg
gccctcaaacacggcctcacaccgatcgtgtgtatcggtgaggcacttgacatccgggaa
gccggagatcacgtccagtacaacgtgaactccttgcgtgggtcactggccggcctcagc
gccgaacaggtgggcaaggtggttatcgcctacgagccggtgtgggccatcggcaccggg
cgggtggccagcgccgccgacgcgcaggaagtgtgcgccgcgatccgcgccgagttggcg
caaatcgcgaacgccgacgtggcggggtctgtccgggtcttgtatggcggctcggccaac
gccaagaatgtcggcgagatcgttgcgcaggaggatgtcgacggagcgttggtcggtggc
gcctcgctggacggcgagcagttcgcccagatgtcggcgatcgccgcgggcggtccgctg
ctttag

DBGET integrated database retrieval system