KEGG   Mycobacterium abscessus ATCC 19977: MAB_2819Help
Entry
MAB_2819          CDS       T00657                                 

Definition
(RefSeq) Putative steroid dehydrogenase
  KO
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
mab  Mycobacterium abscessus ATCC 19977
Brite
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     MAB_2819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2869234..2870025
Genome map
AA seq 263 aa AA seqDB search
MHWYTGNSIYDTVLTAAFAFAAFVIVGGFFAQSSYGRFSTTKLGLNLNPKLGWWLMEIPA
TVVFLVCYLTGPHRLETAPLVLAAIWMLHYANRGWFFPLAIRQVPGKRSTFNVSVVVMGM
LVTSMHGYLNGTLFSHDFFGQYSDAWLHDPRFLLGLAVYLCGFTLLLSSESIVRNLRDKK
NPGAAEYRIPFGGGFRFVTSPAYLGELIAWSGFALLTWALPGVVILLITAGNLIPRALAT
HRWYQEKFIDYPADRKALIPKII
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcactggtataccggaaattccatctacgacaccgtgctgacggcggctttcgcgttc
gcggcgttcgtgatcgtcggaggcttcttcgcacaaagctcgtatggccgcttctccacc
acgaaactcgggctcaatctgaatccgaagctcggctggtggctgatggagataccggcg
acggtggtatttcttgtctgctacctgaccgggccccaccggctcgagaccgccccgctg
gtcctcgccgcgatctggatgttgcactacgccaaccgcggctggttcttcccgctggcc
atccgccaggtgccgggcaagcgcagtaccttcaacgtctcggtcgtcgtcatgggcatg
ctggtgacgtcgatgcatgggtacctcaatggcacgctcttcagccatgacttcttcggg
cagtactccgatgcctggctgcacgatccgcggttcctactcggcctggcggtctatctg
tgcgggttcacgctgctactcagttccgagtcaatcgtccgtaacctgcgtgacaagaag
aaccctggcgcggccgaataccgcatcccattcggcggtgggttccggttcgtcaccagc
ccggcatacctcggcgagctgatcgcctggtccggcttcgccctgctgacctgggcattg
cccggtgtggtgatcttgttgatcaccgccggcaacctcatcccccgcgcgctggccacc
caccgctggtaccaggagaagttcatcgactaccccgccgaccggaaggcgctgatcccg
aagatcatctag

DBGET integrated database retrieval system