KEGG   Mycobacterium abscessus ATCC 19977: MAB_2823cHelp
Entry
MAB_2823c         CDS       T00657                                 

Definition
Probable guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mab00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2873065..2873565)
Genome map
AA seq 166 aa AA seqDB search
MRRLRDEVDGLFFSVSATTRAPRPGEVDGVDYHFVTAEEFQRLIDTDALLEWADIHGGLQ
RSGTPAAPVREAMEAGRPTLIEVDLAGARAIKAALPQALAVFLAPPSWEALVDRLTGRGT
ESESVIARRLETATVEMAAQTDFDVVIVNDQLENACAKLVSLLVGR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcggctacgcgatgaggtcgacggcctgttcttcagcgtttccgcgaccacccgg
gccccacggccgggtgaggtggacggtgtcgactatcacttcgtcaccgccgaggagttt
cagcggttgatcgacaccgacgcgctgctggaatgggcggacatccacggcggattacaa
cgctcgggaaccccggccgcgcccgtgcgtgaggccatggaggcgggccgcccgacgctc
atcgaggtcgatctggccggtgcccgggcgatcaaagccgcgctcccgcaggctctcgcc
gtctttctggcgccaccgagctgggaggcgctggtggatcggctgaccggccggggcacc
gaatcggagtccgtgattgcccggcggctggaaacggccacggtggaaatggcggcccaa
accgactttgatgtcgtcatcgtcaacgaccagttggaaaatgcctgcgcaaagttggta
tcgttattggtcggacgttaa

DBGET integrated database retrieval system