KEGG   Mycobacterium abscessus ATCC 19977: MAB_2831cHelp
Entry
MAB_2831c         CDS       T00657                                 

Definition
Aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MAB_2831c
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAB_2831c
Enzymes [BR:mab01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MAB_2831c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2883029..2883982)
Genome map
AA seq 317 aa AA seqDB search
MRHLLSAADLTRDEATAILDDADRFLQALAGREVKKLPTLRGRTIITMFYENSTRTRVSF
EVAGKWMSADVINVSASGSSVAKGESLRDTALTLRAIGADALIVRHPASGVAAQLAQWTA
EGEGGPAVVNAGDGTHEHPTQALLDALTIRQRLGSLEGRRVVIVGDILHSRVARSNALLL
NTFGAEVVLVAPPTLLPVGVGTWPVTVTHDLDAELPGADAVLMLRVQAERMTGGFFPSAR
EYSVLYGMSEARQRLLPEHAVVLHPGPMLRGMEIASAVADSSQSGVLQQVSNGVHIRMAV
LFHLLVGSSDSPEAVPA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagacatctcctctccgcggccgacctcacgcgtgacgaggccaccgccatcctcgac
gacgccgaccggttcctgcaggcgctagccgggcgtgaggtcaagaagctgccgaccctg
cgcggccgcaccatcatcacgatgttctatgagaactccacgcgcacaagggtttccttc
gaggtcgcgggcaagtggatgagcgcggacgtcatcaacgtcagtgcctccggttcctcg
gtggccaagggggagtcgctgcgcgacaccgcgttgaccctgcgcgcgatcggcgccgac
gcgttgatcgtccgccacccggcctccggggtagccgcacagctggcgcagtggaccgcc
gaaggtgagggcggtccggccgtcgtcaatgcgggtgacggcacgcatgagcaccccacc
caggcgttactcgacgcactgacgatccggcagcggcttggcagtctcgaagggcgccgc
gtcgtcatcgtcggagacatcctgcacagccgggtcgcccggtcgaatgctttgttgctc
aacacgttcggcgcagaggtggtgctggtggcgccgccgacgctgctgcccgtcggtgtc
gggacctggccggtgacggtgacccacgacctggacgccgagttgccgggggccgacgcg
gtgctgatgctgcgggtccaggccgagcgcatgaccggcggcttttttccgtcggcccgc
gagtactcggtcctatacggcatgtccgaggccaggcagcggctgctgcccgaacacgcg
gtagtgctgcaccccggacccatgctgcgcggcatggagatcgcgtccgcggtggctgat
tcttcgcaatccggtgttctgcaacaggtatcgaatggagtgcatatccgcatggccgtg
ctgttccacctgctggtcgggtcctccgatagccccgaggcggttccggcatga

DBGET integrated database retrieval system