KEGG   Mycobacterium abscessus ATCC 19977: MAB_2883cHelp
Entry
MAB_2883c         CDS       T00657                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mab00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MAB_2883c
Enzymes [BR:mab01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MAB_2883c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2938123..2938731)
Genome map
AA seq 202 aa AA seqDB search
MIASVNGEVIDIALDHVVIEAAGVGYRVNATPATLSTLRRGTQIRLITAMIVREDSMTLY
GFTDTDARDLFTTLLGVSGVGPKIAMATLAVYDAPTLRQALADGDVAALTRVPGIGKRGA
ERLVLELREKVAAAPGGTTELGRGTASLVRSQVVEALIGLGFAAKQAEQATDTVLAQDNP
GDTGADVSGVLRSALALLGKTR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgattgcatcggtcaacggcgaggtcatcgacatcgcgctcgaccatgtggtgatcgag
gcggccggcgtggggtaccgcgtgaacgccacaccggccacgctctccacgctgcggcgc
ggcacccagattcggctgatcacggcgatgatcgtccgtgaagactcgatgacgctttat
ggcttcaccgacaccgatgcccgcgatctgttcacgacgctgcttggtgtctccggggtg
gggcccaaaatcgcgatggccaccctcgcggtctatgacgcaccgaccctgcgccaggcg
ctggccgacggcgatgtcgccgcgctcacccgggtgccggggattggtaagcgtggggcc
gagcgcttggtgctggagttgcgggagaaggtggctgccgctccgggcggcaccaccgaa
ctggggcgtggcactgcgtcgctggtgcgctcccaagtcgtcgaggcactcatcggactt
ggctttgccgcaaaacaagccgagcaagccaccgacaccgttctggcccaagacaatccg
ggcgatacgggcgcggatgtttccggagtgctgcgctcggcactggcgttgctgggtaag
acgcgatga

DBGET integrated database retrieval system