KEGG   Mycobacterium abscessus ATCC 19977: MAB_2929cHelp
Entry
MAB_2929c         CDS       T00657                                 

Definition
Putative urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MAB_2929c
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    MAB_2929c
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     MAB_2929c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2984715..2985623)
Genome map
AA seq 302 aa AA seqDB search
MGIVLAGNQYGKAENRVVRIYRDTPRHEIKDLNVGSALRGDFAAAYTDGDQRKVLPTDSQ
KQTIYAYAKEKGIETIEQYGLELARHFVDDYEPVTGARIEIDEYAWERVTVDGREHDHTW
VRKGQEVRTAEVTVDGVGAQQQTWVIGGLKDLVVLKSTGSEFHDFLEDKYTILQPTTDRV
MATSLVAKWRFVGTDIDWDNTYFGVKSLILERFATVHSLALQQTLYEIGKAILESYPSIA
EVRLSAPNKHHFVYDLSPFGLDNPNEVFHADDRPYGLIQAAVTRDDAPDAGPAWSPHLSW
LV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcgttctcgcaggcaatcaatacggcaaggccgagaaccgggtggtccggatc
taccgggacaccccacgccacgagatcaaggatctcaacgtcggcagcgcgttgcgcggg
gatttcgccgcggcctataccgacggcgaccagcgcaaggtgctgcccaccgacagccag
aagcagaccatctatgcctacgccaaggaaaaaggcatcgagaccatcgagcagtacggg
ctcgagctggcgcgccacttcgtggacgactatgagccggtgacgggcgctcgtatcgag
atcgatgaatatgcctgggaaagagtgacggtcgacggacgcgagcacgatcacacctgg
gtgcgcaaaggtcaggaggtgcgcacggccgaggtcaccgtggacggtgtcggggcccag
cagcagacctgggtgatcggcgggctcaaggatctggtcgtgctcaaatcgacgggctcg
gagttccatgatttcctcgaggacaagtacacgatcctgcagccgacgacggaccgggtg
atggccacctcgctggtggccaagtggcgctttgtgggcaccgatatcgattgggataat
acatatttcggtgtaaagtcgctcatcctcgagcggttcgccactgtgcactcgctggcc
ctgcagcagacgttgtacgagattggcaaggcgatcctggagtcttatccgtcaatcgcc
gaagtgcggctctcggcacccaacaagcaccacttcgtctacgacctatcacctttcggg
ctggacaatcccaacgaggtgttccatgccgatgaccgtccgtatgggttgattcaggcc
gcggttacccgtgatgacgcccccgatgcggggccggcctggtctccgcatctgtcctgg
ttggtttag

DBGET integrated database retrieval system