KEGG   Mycobacterium abscessus ATCC 19977: MAB_3008Help
Entry
MAB_3008          CDS       T00657                                 

Definition
Probable polyphosphate glucokinase PpgK
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAB_3008
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAB_3008
   00520 Amino sugar and nucleotide sugar metabolism
    MAB_3008
Enzymes [BR:mab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     MAB_3008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3066336..3067139
Genome map
AA seq 267 aa AA seqDB search
MTATDSAPAATAADPSNTPQQAFGIDVGGSGIKGAIVDLTTGEMVGERVKYPTPQPATPK
AVAETIARVVRDFSWTGPVGVTYPGVIVRGEARTAANVDKSWLGVNVHDIISTELGGQTV
TVLNDADAAGLAEDRYGAGKDQSGVVVLLTFGTGIGSAVLHNGILLPNTEFGHIQVDGME
AEHRAASSVKEKNDWSYKQWAPEVTKVLEAVENALWPDLFIVGGGISRKADKWVPLLTNR
TPVVAAALQNTAGIVGAAMAAHAGVSP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaccgactccgcaccggccgcaaccgcggcggacccctccaacacgcctcag
caggcgttcggcatcgacgtcggcggcagtgggatcaagggtgcgatcgtggatctgacg
accggcgagatggtcggcgagcgggtcaagtaccccacacctcagcccgccacgccgaag
gctgtcgcagagaccattgccagagtcgtgcgtgatttctcctggaccgggcccgtcggt
gtgacgtaccccggcgtgatcgtgcgcggcgaggcgcgcaccgccgccaacgtcgacaaa
tcgtggctgggcgtcaacgtccacgacatcatcagcaccgaacttgggggtcaaaccgtc
accgtcctcaacgatgccgatgccgccgggctggccgaggaccgatacggcgcgggcaag
gatcagtcgggtgtcgtggtcctgctgacgttcggaaccgggatcggctctgccgtcctg
cacaacggaatcctgttgcccaataccgagttcggacatatccaggtggacggcatggag
gccgagcaccgcgcggcgtcatcggtcaaggaaaagaacgactggagctacaagcagtgg
gcgcccgaggtcaccaaggtgctggaagcggtcgagaacgcgctgtggccggatctgttc
atcgtgggcggcggtatcagccgcaaggccgacaaatgggtgccgctgctgaccaaccgc
acacccgtcgtggccgctgcgctgcagaacaccgcggggatcgtcggcgcggcgatggcc
gcacacgctggcgtttcgccttag

DBGET integrated database retrieval system