KEGG   Mycobacterium abscessus ATCC 19977: MAB_3090cHelp
Entry
MAB_3090c         CDS       T00657                                 

Definition
Dihydrofolate reductase DfrA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MAB_3090c
   00670 One carbon pool by folate
    MAB_3090c
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MAB_3090c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3134359..3134850)
Genome map
AA seq 163 aa AA seqDB search
MTGTIGLIWAQTRAGVIGADGAIPWRLPEDQARFKRITMGHTVIMGRKTWESLPGSVRPL
PGRPNIVLTRDALFEPDGALAVGCADAALAASDEAPWVIGGGEIYRLFLPLAQRCEVTVV
EADVPGDALAPELGEGWVVEENDWQTSESGLRYQFLSYRKVDG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaaccatcgggctgatctgggcgcaaacccgagccggcgtcatcggcgcggac
ggtgccattccctggcggctacccgaagaccaggcacgtttcaagcgaatcaccatgggg
cacacagtgatcatggggcgcaagacctgggagtcgctgcccggtagtgtccgtcctttg
ccgggtcggcccaatatcgtgctgaccagggatgccctgttcgagcccgacggggcattg
gccgtcggctgcgcggacgcggccctggcggcttccgacgaggcgccctgggtcatcggc
ggcggagagatctatcggctgtttctgccgttggcacaacgctgcgaagtgacggtggtg
gaggccgacgtgccgggtgacgcgcttgctccggaactcggagaaggctgggttgtcgag
gaaaatgactggcagacaagcgagtccggcttgcgctatcaattcctgagttatcggaaa
gtcgacgggtga

DBGET integrated database retrieval system