KEGG   Mycobacterium abscessus ATCC 19977: MAB_3157cHelp
Entry
MAB_3157c         CDS       T00657                                 

Definition
Possible magnesium-chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MAB_3157c
Enzymes [BR:mab01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MAB_3157c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3203322..3205190)
Genome map
AA seq 622 aa AA seqDB search
MASATAGYPLSAIVGHDRLRLALVLSAVRPDIGGVLIRGEKGTAKSTAVRALASVLGSVD
GARLVELPIGATEDRVVGSLDLQKVLRDGEHAFSPGLLARADGGVLYVDEVNLLHDHLVD
VVLDAAAMGRVHVERDGVSHSYDARFVLIGTMNPEEGELRPQLLDRFGFAVDIHASRDVE
VRAEVIRRRLAYEADPAGFVSRYASEEAELAARIADARQLLARVVLPDAELRRIATLCAA
FDVDGMRADLVVARAAIAHAAWRGADTVGEPDIRVAAELALPHRRRRDPFDEPGLDPDQL
DQAMRDSAPPQDQDGEDPDPEPDGPGGGASDSAPDPAKASDSQQDSAYAAGSSRPSPAPS
ATFRTKTLRVPGVGMGAPGKRSVARNRAGKVIAPSSDEGFGVHVIGTLMSAASRVTEPGR
LPRPVLTDLQWAIREGREGNLVIFVVDASGSMAARQKMSAVSGATLSLLRDAYQRRDKVA
VITFRGQDAAMLLAPTGSTHIAGRRLQRFDTGGKTPLAQGLLAARDLVARERGRDPHRRA
LVVVLTDGRATGGRDPLGRTRRASALLRAEQVACVVIDCETSFVRMDLAVTLAQQLDAPV
IQLDHLNADRLAGVVRGATAAA
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgccacagccggatacccgctgagtgcgatcgtcggccacgatcggctgcga
ttggccctggtgctttcggcggtgcggcccgacatcggcggtgtgctcatccgtggcgaa
aagggcacggccaaatcgactgcggtgcgcgccctggcgtcggtactgggttcagtcgac
ggggcacggctggtggagctgcccatcggtgccaccgaggatcgggtcgtgggctccctg
gacctgcagaaggtattgcgcgacggcgaacacgctttctccccggggcttctggcgcgt
gccgacggtggcgttctgtacgtggacgaggtcaacttactgcatgatcaccttgtcgat
gtggtcctggacgcggcggcgatgggccgggtacatgtggagcgcgacggcgtatctcat
tcgtacgatgcgagattcgtgttgatcggcaccatgaatcccgaggagggggagctgcgt
ccccagctgctcgaccgtttcggattcgcggtggacattcatgcctcccgtgatgtcgag
gtgcgggccgaagtcatccggcggcggcttgcctatgaggcagatcccgcgggtttcgtc
tcgaggtacgcatcggaggaggccgagctggcggcccgtattgccgatgctcggcagcta
cttgctcgagttgtcctgcccgacgccgaattacggcgcatagcgaccctgtgtgctgcc
tttgacgtggacggaatgcgtgccgatctggtggtggcgcgcgctgcgatcgcccacgcg
gcgtggcgtggcgccgacaccgtcggtgagcccgatatccgagtggcagcggagctggca
ctgccacatcggcgccgccgggatccgttcgatgaaccgggtctggatccggatcagctc
gaccaggcgatgcgtgacagcgccccgccgcaggatcaggatggggaagatcctgacccc
gagccggacggcccgggcggtggtgcgtccgattctgccccggatcctgcgaaagcaagt
gattcgcagcaagattcggcgtacgcggctgggtcgtcgcggcccagcccggcgccttcg
gcgacctttcgcaccaagactttgcgggttccgggagttggcatgggagccccggggaag
cgctccgtggcccgcaaccgcgccggcaaggtgattgcgccgagttcggacgagggattc
ggggtgcatgtgatcggcaccttgatgtccgccgcgagtcgggtgaccgaacctgggcgg
ctacccagaccggtgcttaccgatctgcagtgggcgataagggaaggccgcgaaggcaac
ctggtgatctttgtggtcgatgcctcggggtccatggccgcgcgccagaagatgtcggca
gtcagcggcgcgaccttgtccctgctgcgtgatgcctatcagcgccgtgacaaggtcgcg
gtcatcacgttccgcgggcaggatgccgccatgctgctggcgcccaccggctcgactcat
atcgcgggccgcaggctgcagcggttcgataccggcggcaagactcccttggcgcagggt
ctgctggccgcgcgtgacttggtggcacgcgagcgtggacgtgacccgcaccggcgcgct
ttggtggtggtgctcaccgacgggcgtgctaccggtggtcgggaccccttggggcgcaca
cgtcgcgcttcggccctgctgcgtgccgaacaggtcgcctgcgtggtgatcgactgtgag
acatctttcgtgcggatggatttggctgtcactctggcgcagcagctcgacgcgccggtg
atccagcttgaccatctgaacgctgaccggctcgccggagtggtgcgcggcgcgactgcc
gctgcgtga

DBGET integrated database retrieval system