KEGG   Mycobacterium abscessus ATCC 19977: MAB_3365Help
Entry
MAB_3365          CDS       T00657                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAB_3365
Enzymes [BR:mab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MAB_3365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3415224..3416786
Genome map
AA seq 520 aa AA seqDB search
MTPSKKPVPGLFTMVLHTHLPWLANHGRWPVGEEWLYQSWSAAYLPLFKVLRTLAAEGRE
NLLTLGITPVVAAQLDDPHCLTGLHSWLANWQLRAFEASTISSTDAEPGTASSPEMLRAF
GVREYQTATAALDEFDTYWRHGGSGPLRNLIDAKAIELLGGPLAHPFQPLLHPRLREFAL
REGLADAAQRFGHAPTGIWAPECAYAPGMEEGYAAAGVKHFMVDGPSLQGDTSLGRTVGD
SDVVAFGRDLAVSYRVWSPKSGYPGHAAYRDFHTYDHDTGLKPARVTGRNVPSESKAPYD
PERANAAIDIHVRDFVDTVRQRLVDESSRIGRPAHVIAAFDTELYGHWWYEGPTWLERVL
RALPEAGIQVGTLEQAREQGYVGEPFDLPASSWGSGKDWHVWNGEKVADLVQLNTEVVDT
ALTAVDKALNEQPAPHTRNRVADQILREALLTVSSDWPFMVSKDSAADYARYRAHLHAHA
TREIAGALASGRHDVASRLADGWNRADGLFGALDARRLPR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccatccaagaagcccgttccaggccttttcaccatggtgctacatacacacctg
ccgtggctggccaaccatgggcgctggccggtcggcgaggagtggctataccagtcttgg
tccgccgcatacctgccgctgttcaaggtgttgcgcacactggccgccgagggccgggag
aacctgctcacgctgggcatcacccccgtggtggccgcgcagctagacgatccgcactgc
ttgaccgggctgcacagctggctcgccaactggcagctgcgtgcattcgaggcttccaca
atcagcagcaccgatgccgaaccaggcaccgcgtcgagcccggaaatgttgcgagcgttc
ggagttcgcgagtatcagactgctaccgctgccctcgatgagttcgacacgtactggcgt
cacggcggcagcgggccgctgcgcaacctgatcgatgccaaagccatcgaactgctgggc
ggcccactggctcatccgttccagccgctgttgcacccgcgcctgcgcgagttcgcactg
cgcgaaggattggcagatgccgcacagcgtttcgggcatgcacccaccggtatttgggcg
cccgagtgcgcctacgccccgggtatggaagagggctacgcggcggcaggcgtcaagcac
ttcatggtggatggtccgtccctacagggagacacgtccctgggccgcacggtgggcgac
tccgacgtggttgccttcggccgcgacctggcggtgagctaccgcgtgtggtccccgaag
tccggatatccgggccatgccgcctaccgcgacttccacacctatgaccatgacaccgga
ctcaagccggcccgtgtcaccggacgcaatgtgccatcggaatccaaggcaccctatgac
cccgagcgcgccaatgccgcgatcgacatccatgtccgcgatttcgtggacaccgtccgc
cagcgtctcgtcgacgaatccagccgcatcgggcggcccgcgcacgtcatcgccgccttc
gacaccgagctctatggacactggtggtacgaagggcccacctggctagaacgggtgctg
cgcgcgctacccgaagccggtattcaggtgggcacgctggagcaggcccgcgagcaggga
tatgtgggcgagccgttcgacttgcccgccagttcatggggctccggcaaggattggcat
gtgtggaacggcgagaaggtagccgacctggtgcagttgaacaccgaggtcgtcgacacc
gcgctcaccgcggtggacaaggctctcaacgagcaacccgcgccgcatacccgcaaccgg
gtggccgatcagatattgcgcgaagcgctgttgaccgtgtccagcgactggccgttcatg
gtcagcaaggattcggcggccgactacgcgcgctaccgcgcgcacctgcacgcacacgcc
acccgcgagattgccggcgccctggccagcggacgtcacgacgtggcatctcgattggcg
gacggttggaatcgcgcggacggattgttcggcgcgcttgatgcccggaggctgccccga
tga

DBGET integrated database retrieval system