KEGG   Mycobacteroides abscessus ATCC 19977: MAB_3520cHelp
Entry
MAB_3520c         CDS       T00657                                 

Definition
(RefSeq) Possible transcriptional regulatory protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00860  Porphyrin and chlorophyll metabolism
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01120  Microbial metabolism in diverse environments
Module
mab_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MAB_3520c
Enzymes [BR:mab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MAB_3520c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-GeneID: 5966020
NCBI-ProteinID: YP_001704250
UniProt: A0A2C9Y2V2
Position
complement(3565533..3566687)
Genome map
AA seq 384 aa AA seqDB search
MPRNEPERRLDGFTIGVTAARRSEELIALLERRGAAVVHAAAIRIIPLADDAELRDATEL
VIANPPDLTVATTGIGFRGWIEAADEWGVADGLKSALESGRLVARGPKATGAIRQAGLRE
EWSPASESSAEVLDRLLEEGVEGRRIAVQLHGAATEWEPIADLCEALTIAGAQVIRVPVY
RWEPPEDQRPMDRLISMAINAELDGISFTSAPAVASMLGRAKATGRLDELLAALRARVAP
LCVGPVTAAPLEVLGVPTTQPERARLGALARHIADELTRRAPRFHAGGHIVSVRSCGIAV
DGETRQISPAGMALMKRLMVRPGQVVSREDLLAALPGGGDDTHAVETAMTRLRAALGAPK
VIQTVVKRGYRLAIDPTTIGECHG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcgtaacgagccagaacgtcggctcgacgggttcacgatcggtgtcaccgccgcg
cgccgttcggaggaactgatcgcgctgttggagcgtcgcggggccgctgttgtgcatgcc
gcggccatcaggatcatcccgctggccgacgatgccgaacttcgggacgcgaccgaactc
gtcatcgccaacccgccggatctgaccgtggccaccaccggcatcggtttccgcggctgg
atcgaggctgccgatgagtggggtgtggccgacggtctcaagtcggcgctggagtccggg
cgtttggtcgctcgtggacccaaggccaccggagcgatccgtcaggcggggttgcgtgaa
gaatggtcgcccgcatcggaatcgtcggcagaggtattggatcgcctgctcgaagaaggt
gtcgagggccggcgtatcgccgtgcaactacacggcgccgccaccgaatgggagcccatc
gctgacctatgcgaggcgctgaccatcgctggcgcgcaagtgatccgggtgccggtgtac
cgttgggagcctccggaggaccagcggccgatggaccgcttgatctccatggcgatcaac
gccgagctggacgggatcagttttaccagtgcgcccgcggtggcctcgatgttggggcgt
gccaaggcgaccggccgtttggatgagctgctggccgcgttgcgggcccgggtggcgccg
ttgtgtgttgggccggtgaccgcggctccgctggaggtactcggtgtgcccaccacgcag
cccgagcgggcgcggctgggtgcattggccagacacattgccgatgaactgaccaggcgg
gcgccacggttccacgccggcgggcatatcgtcagcgtgcgcagctgcgggatcgcggtt
gatggtgaaactcgccagatctcgccggcgggaatggcgttgatgaagcgtctgatggtg
cgccccggtcaggtggtgtcccgtgaggatctgctggccgcactgccgggtggcggtgac
gacacccatgccgtcgagacggcgatgactcggttgcgtgcggcactcggcgcgccgaaa
gttattcagacagtggtcaagcggggttaccggttggcgatcgatccgaccacgattggg
gaatgtcatggctga

DBGET integrated database retrieval system