KEGG   Mycobacterium abscessus ATCC 19977: MAB_3520cHelp
Entry
MAB_3520c         CDS       T00657                                 

Definition
Possible transcriptional regulatory protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mab00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3565533..3566687)
Genome map
AA seq 384 aa AA seqDB search
MPRNEPERRLDGFTIGVTAARRSEELIALLERRGAAVVHAAAIRIIPLADDAELRDATEL
VIANPPDLTVATTGIGFRGWIEAADEWGVADGLKSALESGRLVARGPKATGAIRQAGLRE
EWSPASESSAEVLDRLLEEGVEGRRIAVQLHGAATEWEPIADLCEALTIAGAQVIRVPVY
RWEPPEDQRPMDRLISMAINAELDGISFTSAPAVASMLGRAKATGRLDELLAALRARVAP
LCVGPVTAAPLEVLGVPTTQPERARLGALARHIADELTRRAPRFHAGGHIVSVRSCGIAV
DGETRQISPAGMALMKRLMVRPGQVVSREDLLAALPGGGDDTHAVETAMTRLRAALGAPK
VIQTVVKRGYRLAIDPTTIGECHG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcgtaacgagccagaacgtcggctcgacgggttcacgatcggtgtcaccgccgcg
cgccgttcggaggaactgatcgcgctgttggagcgtcgcggggccgctgttgtgcatgcc
gcggccatcaggatcatcccgctggccgacgatgccgaacttcgggacgcgaccgaactc
gtcatcgccaacccgccggatctgaccgtggccaccaccggcatcggtttccgcggctgg
atcgaggctgccgatgagtggggtgtggccgacggtctcaagtcggcgctggagtccggg
cgtttggtcgctcgtggacccaaggccaccggagcgatccgtcaggcggggttgcgtgaa
gaatggtcgcccgcatcggaatcgtcggcagaggtattggatcgcctgctcgaagaaggt
gtcgagggccggcgtatcgccgtgcaactacacggcgccgccaccgaatgggagcccatc
gctgacctatgcgaggcgctgaccatcgctggcgcgcaagtgatccgggtgccggtgtac
cgttgggagcctccggaggaccagcggccgatggaccgcttgatctccatggcgatcaac
gccgagctggacgggatcagttttaccagtgcgcccgcggtggcctcgatgttggggcgt
gccaaggcgaccggccgtttggatgagctgctggccgcgttgcgggcccgggtggcgccg
ttgtgtgttgggccggtgaccgcggctccgctggaggtactcggtgtgcccaccacgcag
cccgagcgggcgcggctgggtgcattggccagacacattgccgatgaactgaccaggcgg
gcgccacggttccacgccggcgggcatatcgtcagcgtgcgcagctgcgggatcgcggtt
gatggtgaaactcgccagatctcgccggcgggaatggcgttgatgaagcgtctgatggtg
cgccccggtcaggtggtgtcccgtgaggatctgctggccgcactgccgggtggcggtgac
gacacccatgccgtcgagacggcgatgactcggttgcgtgcggcactcggcgcgccgaaa
gttattcagacagtggtcaagcggggttaccggttggcgatcgatccgaccacgattggg
gaatgtcatggctga

DBGET integrated database retrieval system