KEGG   Mycobacterium abscessus ATCC 19977: MAB_3608Help
Entry
MAB_3608          CDS       T00657                                 

Definition
F420-0:gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MAB_3608
Enzymes [BR:mab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     MAB_3608
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     MAB_3608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3658268..3659644
Genome map
AA seq 458 aa AA seqDB search
MTPPADSPAPEHGSAAPVQILPVTGLPEFRPGDDVAAAIAGAAPWLRDGDVIVITSKIIS
KAEGRIVAAPTDPEARDTLRRKLIDSESIRVLARKGKTLITENTIGIVQAAAGIDASNVD
TAELVLLPTDPDASAAAVRLALSQRLGVKVAVVITDTMGRAWRNGQTDAAIGSAGIPVLY
GYAGAKDKHGNELQVTEVAIADEISAAADLVKGKLTDVPVAVVRGLTLLDDGSAASDLLR
SGPDDLFWLGTNEALEQGRREAILVRRSIRQFADIPVDPDLLREAIGEALTAPAPHHTHP
VRFVWVRDLTTRRALLDALKQAWAADLTADGRSPESVQKRVARGQILYDAPEIVIPFLVP
DGAHDYPDDRRTAAERTMFTVAVGAAVQALLVALAARQVGSCWIGSTIFAGDVVRKQLVV
DSSWEPMGAIAIGYPHGYPEEGLDPRTPLPPGQMLVEL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaccccacctgcggattctcctgcaccggaacatggttcggcagctccggttcaaatc
ctacccgtaaccggcctgcccgaattccgcccgggcgacgacgtggccgcggccatcgca
ggcgcggcgccatggctgcgtgacggtgatgtgatcgtcatcaccagcaagataatctcc
aaggccgagggacggatcgtcgccgcgcccactgatcccgaagcccgggacacactgcgg
cgcaagttaatcgactccgaatcgatccgcgtgttggcccgcaagggtaagacactgatc
accgagaacaccatcggcatcgtgcaggccgccgcgggaatcgacgcgtcaaacgtcgac
accgccgaactggttctgcttcccaccgacccggacgccagcgcggcggcagtgcggctg
gcgctgtcacaacgcttgggcgtcaaggttgcggtggtgatcaccgacaccatgggacga
gcctggcgcaacggccaaactgatgccgccatcggctccgccggcataccagtcctctac
ggttatgcgggcgcaaaagacaaacacggtaacgaacttcaggtcaccgaggtcgccatc
gccgacgaaatctcggctgccgccgacttggtcaagggcaagctgaccgatgtaccggtc
gcggtggtgcgcggcctgaccctgctcgatgacggcagtgcggcgagcgacctgttgcgt
tccggaccggacgacttgttctggctcggcaccaacgaggcactggagcaaggacggcgc
gaagcaatactcgtgcgccgctccatccgccaattcgcagatatcccagtcgatcccgat
ctgctgcgggaagccatcggtgaagcgctgaccgcacccgcaccgcatcacacacatccg
gtccgattcgtgtgggtgcgcgacctcacgacgcggcgtgcgctcctggacgccctgaaa
caggcctgggccgccgatctcaccgccgacggccgtagcccggaatcagtgcagaagagg
gtggcgcggggacaaatcctttatgacgcacccgaaatcgtgatcccgttcctagtacct
gatggcgcgcacgactatccggacgaccgccgaaccgccgcggagcgcactatgttcacc
gtcgcggttggcgcggcggtgcaggctcttctggtcgccctcgccgcccggcaggtcggc
agctgctggatcggatccaccatcttcgcgggcgacgttgtacgcaagcagctggtagtg
gattcttcgtgggaaccgatgggcgccatagccatcggctatccgcatggctatcccgag
gaaggcctggacccacgcactcccctgccgccgggacagatgctggtggaattgtga

DBGET integrated database retrieval system