KEGG   Mycobacterium abscessus ATCC 19977: MAB_3671cHelp
Entry
MAB_3671c         CDS       T00657                                 

Definition
Probable thymidine phosphorylase DeoA
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MAB_3671c
Enzymes [BR:mab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MAB_3671c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3724075..3725364)
Genome map
AA seq 429 aa AA seqDB search
MANTYAFDMPSIIATKRDGAELSPAAIDWLIGQYTSGDIGEEQVAALLMAIYLRGMNGAE
TAAWTAAILASGERLDLSGLSRPTVDKHSTGGVGDKISLPLVAVVAACGAAVPQLSGRGL
GHTGGTLDKLESVAGIRVDLSNDQIRQQLSDVGAVICAAGASLAPADRKLYALRDITGTV
ESIPLIAGSIMGKKLAEGTAALVLDVKVGAGAFMKSEQRARELASAMVDLGTAHGVATSA
LLTAMDTPLGATAGNAVEVQESLDVLAGGGPEDVVALTVTLAREMLAAAGIDGKDPAATL
TDGTAMDVFRTMIHAQGGDLAVPLPLGQCQETVLAPVGGVMRRIDAMPVGIAAWRLGAGR
SRPGEAVQHGAGVRIHRRPGEAVVAGEPLFTLYTDTQERLPAALDALEGGWEIGAAPTAT
PLIIDRLPV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatacatatgccttcgatatgccgtcgatcatcgccaccaagcgggacggcgcg
gagctgagcccggccgccatcgattggctgattggccagtacaccagcggcgacatcggt
gaggaacaggtcgcggctctgctgatggcgatttatctgcgcggcatgaacggcgccgag
acggcggcgtggacagcggcgatcctggcgtccggcgagcggctggacctgtccgggttg
tcccggccgaccgtcgacaagcactccaccggcggagtgggcgacaagatcagcttgccg
ctggtcgcggtggtcgcggcctgcggagcggcagttccacagctttccgggcgtggcctc
ggacacaccggcggcaccctcgacaagctcgaatccgttgcgggtatccgtgtcgatctc
tccaatgaccagatacgtcagcagctttccgacgtgggagcggtgatctgcgcggccggg
gcgtcattggcgcccgccgaccgaaagctctacgcgctgcgggatatcaccggcaccgtc
gagtcgattccgctcatcgccgggtcgatcatgggtaagaagctggcggaaggtaccgcc
gcgctggttctggacgtcaaggtcggcgcgggcgcgttcatgaaatccgaacagcgcgct
cgtgaattggcctcggcgatggtcgatctgggtaccgcgcacggggtggccaccagcgcc
ctgctgaccgcgatggacaccccattgggagccaccgcgggaaacgcggtcgaggtgcag
gaatcgctcgacgtgctggctgggggagggcccgaggatgttgtcgcgctcaccgtgacg
ctggcccgcgagatgcttgcggcggccgggatcgacggcaaggatccggccgcgacgctg
accgacggcaccgccatggacgtgttccgcacgatgatccacgcgcagggcggtgacctc
gccgtgccactaccgctggggcagtgtcaggagaccgtgctggccccggtcggtggtgtc
atgcgccgtatcgacgcgatgcctgtcgggatcgcggcctggcgcctaggtgccggacgc
agccgcccgggggaggcggtgcagcacggtgccggggtgcgcattcaccgtcggccgggg
gaggcggtggtagccggagaaccactgttcacgctgtataccgacacccaggagcgattg
cccgccgcgctcgacgcgctggaaggtgggtgggagatcggtgcggcaccgaccgctacc
cccctcatcatcgatagacttccggtgtga

DBGET integrated database retrieval system