KEGG   Mycobacterium abscessus ATCC 19977: MAB_3674Help
Entry
MAB_3674          CDS       T00657                                 

Definition
Probable succinate dehydrogenase, hydrophobic membrane anchor protein SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAB_3674
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAB_3674
   00650 Butanoate metabolism
    MAB_3674
  Energy metabolism
   00190 Oxidative phosphorylation
    MAB_3674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3726441..3726923
Genome map
AA seq 160 aa AA seqDB search
MTTPQTGSHTSVRASGRPAPVLERNYDRPAALDNPRAPRRGSGMPNFEKYAWIFMRLSGV
VLIFLALGHLFIMLMWDNGVYRLDFNFVAQRWASPFWQTWDLLMLWLAQLHGGNGMRTII
ADYTRKDSTRFWLNCLLALSIIFTVVLGTYVLLTFNPNIG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcctcagaccggttcgcacacgagcgttcgcgccagcggccgccccgctccc
gtgctggagcgcaactatgaccgccctgcggcactggacaatccgcgcgcaccccgacgg
ggttcgggcatgcccaacttcgagaagtacgcgtggatcttcatgcggctctcgggcgtc
gtcctgatcttcttggcgctgggccacctgttcatcatgctgatgtgggacaacggcgtg
taccgcctcgacttcaatttcgtggcgcaacgctgggcaagcccgttctggcagacctgg
gacctgctgatgctgtggctggctcagctgcacggcggtaacggcatgcgcacgatcatc
gccgactacacccgcaaggattcgacccggttctggctcaattgcttgctggcactgtcg
atcatcttcacggttgtgctcggcacgtacgtcctgctgaccttcaacccgaacatcggt
tag

DBGET integrated database retrieval system