KEGG   Mycobacterium abscessus ATCC 19977: MAB_3719cHelp
Entry
MAB_3719c         CDS       T00657                                 

Definition
Putative cholesterol oxidase ChoD
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MAB_3719c
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     MAB_3719c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3774251..3776008)
Genome map
AA seq 585 aa AA seqDB search
MSSPAAVPVKPEADTDFDVLIVGSGFGGSVTAMRLTEKGYRVGVLEAGRRFADEEFAETS
WDLRKFLWAPMFKCFGIQRIHLLSNCMILAGAGVGGGSLNYANTLYVPPDPFFNDPQWKG
ITDWRAELSPHYEQAQRMLGVVKNPTFTDADRLIKEVADDMGAGDTFVATPVGVYFGPDG
TKTPGVKVPDPYFGGAGPDRVGCTECGSCMTGCRVGAKNTLVKNYLGLAESNGAQVIPLT
TVTAVQQGADGVWRVSTKSTGRWVRKQRKTYTAKYVVLAAGTWGTQNLLFKMKDKGLLPK
LSQRLGVLTRTNSESIVGAGRLEYKDDLDLTHGVAITSSFHPTSDTHIEPVRYGKGSNAM
GLLQTLMTDGDGPKSRWRQLIENARADWRGTFRMFNVTQWSERTVIALVMQHLDNSITTF
TKKTLFWRRLDSKQGHGEPNPTWIPAGNEATRRLAAKIDGVAGGTWGELFNIPLTAHFLG
GAVIGTSPENGVIDPYHRVYGYPTMYVVDGASISANLGVNPSLSITAQAERAASLWPNKG
ETDLRPEQGLPYQRMAPVPPVHPVVPADAPGALRRLPIEPVSSAS
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaccggcagcagtccctgtaaagcccgaagcagataccgactttgacgtactg
atcgtcggatccggattcggcggaagcgtcaccgccatgcgcctgaccgagaagggttat
cgcgtaggtgtcctggaggcgggccgacggttcgcggacgaggaattcgccgagacctca
tgggatctgcgcaagttcctatgggcgccgatgttcaagtgcttcggcatccagcggatc
cacctgctgagcaactgcatgatcctggccggtgccggggtgggtggaggctcgctgaac
tacgccaacaccctctacgtgccaccggacccgttcttcaacgatccgcagtggaagggc
atcaccgactggcgcgccgaactctcaccccactatgagcaggcccagcggatgctcggt
gtggtgaagaaccccaccttcaccgacgccgaccggctcatcaaggaggttgccgacgac
atgggtgccggcgacacctttgtcgcgacaccagtgggtgtgtacttcgggcccgacggc
accaagacccctggcgtcaaagttcccgatccatacttcggcggggccggacccgaccgg
gtgggctgcaccgagtgtggatcctgcatgaccggctgccgggtcggcgccaagaacact
ctggtcaagaactacctgggactggctgaatccaatggtgcccaggtcattccgctcacc
accgtgaccgcggtgcagcagggcgcggacggtgtctggcgcgtctccaccaagtccacc
ggccgttgggtgcgtaagcagcgcaagacctacacggccaagtacgtggtgttggccgcc
ggcacctggggcacgcagaacctgctgttcaagatgaaggacaaggggttgctgcccaag
ctgtcacagcggctgggcgtgctgacccgcacaaactccgaatccatcgtcggcgcgggc
cggttggagtacaaggacgacctggacctcacccacggtgtggccatcacgtcttccttc
cacccgaccagcgacacccatatcgagccggtccgttacggcaagggctccaacgcgatg
gggctgctgcagaccctgatgaccgacggcgatgggccgaagtcgaggtggcgccagctt
attgagaacgcccgtgccgactggcggggcacgttccggatgttcaacgtgacgcagtgg
agcgagcgcaccgttatcgcgctggtcatgcagcacctggacaactcgatcaccaccttc
accaagaagacgttgttctggcggcgtctggacagcaagcaaggccacggggagcccaac
cccacctggattcccgcgggtaacgaggccacgcggcgcctggccgccaagatcgacggc
gttgccggcggcacctggggcgagctgttcaacattccgctgaccgcgcacttcctgggc
ggtgccgtgatcggtaccagcccggagaacggcgtcatcgacccctaccaccgggtgtac
ggctacccgaccatgtacgtggtggacggagcgtcgatctcggccaacctgggcgtcaac
ccgtcactgagcattaccgcacaggccgagcgtgcggcgtcgttgtggcccaacaagggt
gagacggatctgcgtccggagcagggcctgccgtatcagcggatggccccggtgcccccg
gtgcacccggtggtccccgccgatgccccgggggcgctgcggcgtctgccgatcgaaccg
gtgagctcggccagttag

DBGET integrated database retrieval system