KEGG   Mycobacterium abscessus ATCC 19977: MAB_3749Help
Entry
MAB_3749          CDS       T00657                                 

Definition
Putative phosphodiesterase/alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mab00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:mab00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mab02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3803141..3804655
Genome map
AA seq 504 aa AA seqDB search
MTAFPRRTVLRAALLGLAAVPVAACGPALVTTRPRLTHGVASGFPRTDGAVIWARSDRPA
ALIVETAATESFSDTRRFTGPLLTPDADGTGRIRLTGLPADSEVHYRVTLDADGALSEPA
TGVFRTAPATARDVRLIWSGDVAGQGFGINPDIGGMTVFRTMAERNPHFFIHSGDTVYAD
VPIPETLPLPDGRIWRNEISEAKSAVAQTLDQYRGQHAYNLTDANYRYFNAHVPQLVQWD
DHEVINNWYPGEVLDNDKYTEKRVDILARHGHRAFHEWQPLEAREAVDGRVYQRVSYGPL
LDVFLLDMRSYKDPNSPNRQQHGTILGARQAGWLINEMASSTAVWKVVANDLPLALVVPD
GTTDFEAVANGDNDLPLGRETELAHILSQLKARKVRNVVWLTADVHYTAAHEYSPARAAF
TDFDPFWEFVSGPLNAGAGKESTLDGTFGPRADFVHAAPPGKQSPLDGYQHFGQIDIDGG
SGDLTVTLCDAAGAALYTRTLARI
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacagcttttccgcgccgcacagtgctgcgggccgctctgctcgggctcgcggcggtg
ccggtggccgcatgtgggccggcgctcgtgacaacgcgcccgcggttgacccacggagtc
gcgagcggattcccgcgtaccgacggcgcggtgatctgggcccgctcggatcgacccgcc
gccctgatcgtcgaaaccgctgccaccgaaagtttttcggacacaagacgcttcaccggc
ccgttgcttactccggacgcggacggtaccggccgaatccgcctcaccggcctacccgcg
gattcggaggtgcactaccgggtgacgctcgacgcggacggggcgctcagcgagcctgcc
accggcgtcttccgaaccgcgccggcgacggcccgcgacgtccgactgatctggtccggc
gacgtggcggggcaggggttcggcatcaatcccgacatcggcggaatgacggtcttccgc
accatggccgagcgaaatccccacttcttcatccacagtggcgacacggtgtacgcggat
gtcccaattcccgagaccctgcccctgcccgacggacggatctggcgcaacgagatatcc
gaggcgaaaagcgctgtcgcgcagacccttgaccagtatcgcggacaacacgcctataac
ctcaccgatgccaactaccggtacttcaatgcccacgtgcctcagcttgtgcagtgggat
gaccacgaggtgatcaacaactggtaccccggcgaggtgctcgacaacgacaagtacacc
gaaaagcgggtcgacatactcgcgcggcacggacatcgggcattccatgaatggcaaccg
ctggaagcccgcgaggccgtggacggacgtgtgtaccaaagagtctcgtacggcccacta
ctggacgtgttcctgctcgacatgcggagctacaaggatcccaactcccccaaccgtcag
caacacggcaccatcctgggtgcccgccaggccggatggctcatcaacgagatggcctca
tccacggccgtgtggaaggtcgtggccaatgacctgcccctggcactggtggtcccggac
ggaacaacggacttcgaggccgtcgccaacggcgacaacgacttacctctcggacgggaa
accgaactggcacatattctctcgcagctcaaggcacgaaaggtgcgcaacgtggtatgg
ctgacggccgacgtgcactacaccgcggcacacgaatactcacccgcccgcgccgccttc
accgacttcgacccgttctgggagttcgtgtcgggtccgctgaacgcgggcgccggtaaa
gagtcgactcttgacggaaccttcggtcctcgtgccgatttcgtccatgcggcaccgccc
ggcaagcagtcaccactggacggctatcaacacttcgggcagatcgacatcgacggcggc
agcggcgacctgacggtcacactgtgtgacgcggcgggcgcggccctgtacacccgcacc
ctggcgcgcatttag

DBGET integrated database retrieval system