KEGG   Mycobacterium abscessus ATCC 19977: MAB_3990cHelp
Entry
MAB_3990c         CDS       T00657                                 

Definition
Probable delta-aminolevulinic acid dehydratase HemB (porphobilinogen synthase)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MAB_3990c
Enzymes [BR:mab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MAB_3990c
Exosome [BR:mab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAB_3990c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4035220..4036203)
Genome map
AA seq 327 aa AA seqDB search
MPFPYQRPRRLRATPAIRRLVAETTLAPRQLVLPMFVADGLTEPKAISSLPGVVQHSTES
LRRAAEDAVKAGVGGLMLFGVPQEKDKDATGSAGLCADGILNRALSVLSADLGDATVLMA
DTCLDEFTDHGHCGVLDAAGRVDNDATLTQYVHMAVAQANSGARVVGPSGMMDGQVAAIR
AGLDAAGHSDVIIMAYTAKYASAFFGPFREAVGSSLRGDRRTYQQDVANGREALRELELD
VQEGADIVMVKPAMAYLDVLRQVADVSPVPVAAYQVSGEYAMICAAAQNNWIDLQAMALE
TLTSIRRAGADIVLTYWAAEAAGWLSD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
ttgccttttccctaccagcggccgcgccgcctgcgggccaccccggcgatccgtcggttg
gttgccgagaccacgttggcgccgcgacagttggtgctgccgatgttcgtggcagacggc
ctcaccgagcccaaggcgatctcgtcgctgccgggggtggtgcagcacagcaccgaatcg
ctgcgccgcgcggccgaggacgcggtcaaggccggggtgggcgggctgatgctgttcggg
gtgccacaggagaaagacaaggacgccaccggtagcgccggtctgtgcgccgacggcatc
ctgaaccgggcgctgtcggtgctgtccgcggacctgggggacgccaccgtcctgatggcc
gatacctgccttgacgagttcaccgatcacggtcactgtggggtgctggacgccgccggc
cgggtcgacaacgacgccacccttacgcaatacgtgcacatggctgtggcgcaggcaaat
tcgggtgcgcgagtggtggggcccagcggcatgatggacggccaggtggccgcgattcgg
gcgggcctggacgccgccgggcacagcgacgtgatcatcatggcctacaccgccaagtac
gcgtcggcgttcttcggcccgttccgggaggccgtgggctcctcgctgcgcggagaccgc
cgcacctatcagcaggacgtggccaacggacgagaagccctccgcgagcttgagcttgat
gtccaggagggcgccgacatcgtcatggtgaaaccggcgatggcctacctcgacgtgttg
cggcaggtggccgatgtctcgccggtgccggtggctgcctaccaggtgtcgggcgagtac
gcgatgatctgtgctgcggcgcaaaacaattggattgacctgcaggctatggcgctggag
acattgacctccatccggcgtgcgggggccgatatcgtgctgacctactgggcggccgag
gccgcgggttggctttccgactag

DBGET integrated database retrieval system