KEGG   Mycobacterium abscessus ATCC 19977: MAB_4049cHelp
Entry
MAB_4049c         CDS       T00657                                 

Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAB_4049c
   01230 Biosynthesis of amino acids
    MAB_4049c
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAB_4049c
  Energy metabolism
   00680 Methane metabolism
    MAB_4049c
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAB_4049c
Enzymes [BR:mab01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MAB_4049c
Exosome [BR:mab04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MAB_4049c
  Exosomal proteins of melanoma cells
   MAB_4049c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4095105..4095875)
Genome map
AA seq 256 aa AA seqDB search
MSGETSSKTNGATLILLRHGESQWNAKNLFTGWVDVDLTEKGRSEAQRGGELLAQQGLLP
DILFTSLLRRAINTAHLALDTADRLWIPVVRDWRLNERHYGALQGLDKAETKAKYGEEQF
MAWRRSYDTPPPPIERGSHYSQDQDPRYADIDGGPLTECLADVVARFVPYYEEAIVPELR
AGKTVLVAAHGNSLRALVKYLDGISDEEIVGLNIPTGIPLRYDLDENLKPVTPGGVYLDP
EAAAAGAAAVANQGAK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagacctccagtaagacaaacggagccaccctgatcctgctgcgccacggc
gagagccagtggaacgccaagaacctgttcaccggctgggtcgatgtcgacctgacggaa
aagggcaggtccgaggcacagcgcggtggtgagctgctggctcagcagggtctgctgccc
gacattctgttcacctcgctgctgcgtcgcgccatcaataccgcgcatctggctctcgac
accgccgaccggctgtggattccggtggtgcgggactggcgcctcaacgagcggcactac
ggcgcgctgcagggtttggacaaggcggaaaccaaggccaaatatggcgaagagcagttc
atggcgtggcgccgcagctatgacaccccgcccccacccatcgagcggggcagccactac
agccaggatcaggatccgcgctacgccgatatcgacggtgggccgctgaccgaatgtctg
gccgacgtggtggcgcgattcgtgccgtactacgaagaggccattgtgccggagctgcgt
gcgggcaagacagtgctcgttgccgcgcatggcaattcgctgcgcgcgctggtcaaatat
ctcgacgggatctccgacgaggagattgtcggtctgaacattcccaccggcattccgttg
cggtacgacctcgacgaaaacctcaagccggtcactcctggcggggtctacctggatccg
gaggctgcggccgccggcgcggccgcggtagccaaccagggtgcaaaataa

DBGET integrated database retrieval system