KEGG   Mycobacterium abscessus ATCC 19977: MAB_4303Help
Entry
MAB_4303          CDS       T00657                                 

Definition
Alpha galactosidase precursor
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MAB_4303
  Lipid metabolism
   00561 Glycerolipid metabolism
    MAB_4303
   00600 Sphingolipid metabolism
    MAB_4303
Enzymes [BR:mab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MAB_4303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4379762..4381057
Genome map
AA seq 431 aa AA seqDB search
MSRGRRALILIMLAVIGIVATVSSVHIFRRQPQPGPAIAGLASTPPLGWNSWNVFGCNID
EQRIERTAQAMVSSGMRDAGYRYVVVDDCWFDPRRNASGELRANPARFPHGMKAVADFVH
ARGLLFGIYASPGEATCAQNGGSYPGRTGSRGHEIQDAQTFARWGVDYVKYDWCGPPADV
DELVDSFTIMRDALRATGRPILYSINPNSGTVIPPSRYDSFTGVATMTRVSQDLVPAWGA
IDAYDTSLGVVDALANAAGPGFRCTPQPGFFCDYDMLVAGAPQVAGIDLPPLNTAESRAQ
LALWAEWGSPLIAGNDLTHMPEDIRALLINRDLLAIDQDSLRASATALAGSGGTIWTRPL
GDGSTAIVIVNRDDVAQPFRAAFSALGLPKARRFDVLDVFSGQRSVQQLTYRTSLAAHDA
RLLRVRAIGDQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtggccgccgtgcactgatcctgatcatgcttgcggtgatcggcatcgtggca
acggtgtcgtccgttcacattttccgccgccagccacagcccggcccggccattgccgga
ctggcatcgactcccccactggggtggaattcatggaatgtgttcggctgcaatattgat
gagcagcgcatcgagcggacggcgcaggccatggtgtcgtcgggaatgcgcgatgccgga
tatcggtatgtggtggtcgacgactgctggttcgatccgcgacgcaacgcgtcgggggaa
ctgcgcgcgaaccccgcccgttttcctcacggcatgaaggcagtggccgacttcgtgcac
gcacgcggtctgttgttcggcatctacgccagccccggcgaggctacctgcgcgcagaac
ggcggttcgtacccgggccgcacgggcagccggggacacgagatccaggatgcccagacc
ttcgcacggtggggcgtggattacgtgaagtacgactggtgcggaccacccgccgacgtc
gacgaactggtcgacagcttcaccatcatgcgggatgcgttgcgcgccaccggcagaccg
atcctctacagcatcaacccgaacagcggcaccgtcatcccgcccagccggtacgacagc
ttcaccggggtagccaccatgactcgggtgagtcaagacctggtaccggcatggggtgcc
atcgacgcctacgacaccagccttggcgtcgtcgacgcgttggccaacgcagcagggccc
gggttccgttgcacaccgcagccgggcttcttctgcgattacgacatgctggtcgccggg
gcgccacaggtcgcgggaattgatctgccgccgctcaatacggccgaatcacgagcacag
ctcgccctgtgggcggaatggggatcgcctctgatcgcgggcaacgacctgacacacatg
cccgaggacatccgtgcgctgctgatcaatcgggatctgcttgccattgatcaagattcg
ctgcgcgcgtccgcgacagcactggcgggcagcggcggaaccatttggacccggccactt
ggcgatggatccacggcgatcgtgattgtgaaccgcgacgatgtcgcacagcctttccgg
gctgcgttcagcgcgctggggctgcccaaagcccggcggttcgacgtcctcgacgtgttc
tcgggacaacggtcggtgcagcagctgacgtatcgcaccagcctggcggcacacgatgcc
aggctgctgcgagtacgggcgatcggcgaccaataa

DBGET integrated database retrieval system