KEGG   Mycobacterium abscessus ATCC 19977: MAB_4374Help
Entry
MAB_4374          CDS       T00657                                 

Definition
Acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mab00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mab00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mab00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:mab00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:mab00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4458286..4459221
Genome map
AA seq 311 aa AA seqDB search
MAIIGSGNIGTDLMIKVIRRSRILSMGAMVGIDPTSDGLARAARLGVATTADGVEGLIHM
EQFAEVAIIFDATSAATHRENAARLAPYDKRLIDLTPAAVGPYVVPPVNLGAHIASGATN
LNMVTCGGQATIPIVHAVSRVAPVVYAEIVASISSRSAGPGTRANIDEFTETTARAIEQV
GGAARGKAIIVLNPADPPPLMRDTVFCLVGDADHGTIRRSVKEMIAEVSTYVPGYRLKQD
VQFDRVDEPMRALLRDTTGTVTTKVSVFLEVEGAGHYLPSYAGNLDIMTSAALHTAESMV
RGGDSSQEFGI
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtggccattatcggttcggggaacataggtaccgacttgatgatcaaggtgattcggagg
tcccggatactgagcatgggtgcgatggtgggcatcgaccccacctcggacgggctggca
cgcgcggcacgtctcggcgtggccaccaccgccgacggggtagaaggcttgatccacatg
gaacaattcgcggaggtggcaatcatcttcgatgcaacttcggccgcaacacatcgtgag
aacgcagcacgattggctccctacgataagcgactgatcgacctcactccggccgcagtc
gggccatatgtcgtcccgccggtaaaccttggcgctcacatcgccagtggtgcaacaaat
ctcaacatggtcacatgcggtgggcaggcaacaataccgattgtgcatgccgtatcgcga
gtagcccccgtagtatacgcggaaatcgtggcatcgatatcctctcgttctgccggtccc
ggtacgcgcgccaacatcgatgaattcaccgaaaccacagcccgggccatcgaacaggta
ggtggagcggcgcgcggtaaggcgatcatcgttctgaatcctgccgacccaccaccgctt
atgcgtgacaccgtattctgcctagtcggtgacgccgaccacggtacgattcggcgctcg
gtcaaggagatgatcgctgaggtctccacctacgttcctggatatcgcctcaaacaagac
gtgcagttcgaccgagtcgacgaaccgatgcgtgctctgcttcgcgacaccaccgggacg
gtgaccaccaaagtgtcggtgttcctggaggtggagggcgccggacactatctacccagc
tacgccggcaatctcgacatcatgacgtctgcggccctgcacaccgcggagtcaatggtc
cgtggcggcgattcatcgcaggagttcggcatatga

DBGET integrated database retrieval system