KEGG   Mycobacterium abscessus ATCC 19977: MAB_4458cHelp
Entry
MAB_4458c         CDS       T00657                                 

Definition
Putative secreted hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MAB_4458c
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MAB_4458c
Enzymes [BR:mab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MAB_4458c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4534372..4535499)
Genome map
AA seq 375 aa AA seqDB search
MRAGTVLTGLVVAALTACGGNASEPSKENTSSTKAQAPATAAPAADLACLSTRDRLAQLL
MVGIKDADDARALVRDHHVGGIFVGSWTKKEMLTDGSLHDVITAGPIPAAVSIDEEGGRV
SRLKDLIGPAPSARELAATQTPEQVQALSQERAQKMKDLGITIDFAPDADVTDGDPDGAI
GDRSFSGDPQKVAEYAEASVRGYQAGGVRAVVKHFPGHGHASGDSHTNGVVTPPLEQLKD
NDLVPYRSLVTSGAAVMIGHMQVPGLTGDDPASLSGAAVDLLRKGTGYGAPAYDGVIFTD
DLSSMAAITDRFPIEEAVLKSIKAGVDWALWVSTEKVGSVLDRLESAYNAGELNADAINA
SVRRVLAYKGVPACG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcaggcacagtactgaccggtctcgtcgtcgcggcgcttaccgcttgcggtggc
aatgcctcggagccctcgaaggagaacacgtcgtcgacgaaggcgcaggcgccagcaacc
gctgcgcccgccgctgacctggcctgtctgagtactcgcgaccggttggcgcagctactc
atggtcggcatcaaagacgccgacgacgcccgtgcgctggtgcgcgaccatcacgtcggc
ggcatcttcgtcggcagctggaccaagaaggagatgctgacggacggttcgctgcatgac
gtcatcaccgccggccccattccggctgccgtgagtatcgacgaggagggcggccgggtg
tcgcgcctgaaggatctcatcggcccggcgccgtcggcccgtgaattggccgctacccag
acacccgagcaggtgcaggcgctgagccaggagcgtgcccagaagatgaaggacctcggg
atcaccatcgacttcgctccggacgccgatgtgaccgacggtgatcccgacggtgccatc
ggtgaccgttcgtttagcggcgacccccagaaggtcgccgaatacgccgaggcctccgtg
cgcggataccaggccggcggggtgcgtgccgtggtcaagcatttccccggacatggtcac
gcctcgggcgattcacacaccaatggggtggtgaccccgccactggagcagctgaaggac
aacgatttggtgccgtaccgctcgctggttaccagcggtgctgcggtgatgatcggccat
atgcaggtgcctgggctcaccggcgacgacccggccagcctcagtggggcagcagttgac
ctgctgcgcaagggaaccggctatggcgcgccggcctacgacggtgtcatcttcaccgac
gacctgtcctcgatggccgccatcaccgaccgtttcccgatcgaggaagccgtgctcaag
tcgatcaaggcgggcgtcgactgggcgctctgggtaagcaccgagaaggttggttcggtt
ctggatcgtctggaatcggcatacaacgcaggcgaattgaatgccgatgcgatcaacgcg
tcggtgcgccgggtgctggcgtacaagggtgttcccgcctgcggttag

DBGET integrated database retrieval system