KEGG   Mycobacterium abscessus ATCC 19977: MAB_4777cHelp
Entry
MAB_4777c         CDS       T00657                                 

Definition
Possible cellulase CelA (endoglucanase)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mab00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4888206..4889114)
Genome map
AA seq 302 aa AA seqDB search
MAVLSLGIFLGPVAEADNPLDGQGFYVNPNSAAMRAAQGAGSPELTSIANTPQAYWMDNV
SSPSVDAKYISAAQASGATPVLALYAIPHRDCGSFAAGGFGSADAYKGWIDGVAAAIGAG
PAVVILEPDALAMADCLSGAQRQERFDLMRYAVDTLTRNPATALYIDGGHSRWVSADVMA
ARLNEVGVSKARGFSLNTANFFTTDEEIGYGDAISGMTNGAHYVIDTSRNGAGPTSDALY
WCNPSGRALGTPPTTATASPNADAYLWVKRPGESDGSCDRGDPRAGTFVNQFAIDLARNA
GR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttggccgtgttgagcctgggtatcttcttgggcccggtggcagaggcggacaacccgctg
gatggccaagggttctacgtcaatcccaactcggcggccatgcgtgccgcacaaggcgcg
ggcagccccgagctgacgtccatcgccaatacaccacaggcgtattggatggacaacgtc
tcatccccgagcgtggatgcgaagtacatcagcgcggcccaggcctccggtgccacaccc
gtgttggctctctacgccatcccgcaccgcgactgcggcagcttcgccgccgggggcttc
ggatcggccgacgcatataaaggatggatcgacggtgtggccgccgccatcggggccggg
cccgcggtggtcattctcgagcccgacgcgctcgcgatggctgattgcctctcgggggcc
cagcgccaagagcgctttgatctgatgcgttatgccgtcgacacactgacccggaatccg
gccaccgccctctacatcgacggtggccactcacgttgggtgagcgccgatgtcatggcc
gcccggctcaatgaggtaggcgtcagcaaggcgcggggctttagcctcaacaccgcgaac
ttcttcaccaccgacgaggagatcggttacggcgatgcgatttcggggatgacgaacggt
gcgcattacgtgatcgatacctcgcgcaatggcgccggccccacttccgatgcgctctat
tggtgcaacccgagtggtcgtgcgctcggtaccccgcccaccaccgccaccgcgagtccg
aatgccgatgcctacctgtgggttaagcgtcccggtgagtccgacggctcgtgcgaccgt
ggagacccgagggcaggcaccttcgtgaatcagttcgcgatcgatctggcgcgtaacgca
ggccggtag

DBGET integrated database retrieval system